KEGG   Mus musculus (mouse): 70699Help
Entry
70699             CDS       T01002                                 

Gene name
Nup205, 3830404O05Rik, AV248391, mKIAA0225
Definition
nucleoporin 205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    70699 (Nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
6 B1; 6
AA seq 2008 aa AA seqDB search
MAALLAVNSAASLWGPYKDIWQTVGSALWRRQPEAVHLLDMILKKHKPDFISLFKNPPKN
VQQHEKIQKASSEGVAIQGQQGTRLLPEQLIKEAFIISDLFDIGELSAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLRTLIQSRRGKTWTLELSPELVSMTTRFTDELMEQ
GLTYKVLTLLSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LPKDDTLLLIGHLERVTVEANGSLDAVNLCLLMALLYCFDTSFIDQSTEERDDMIHHLPL
LTERQYVSTIHSRLQDSQPWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAIA
ELAIADNVFLFLSEAVVLAENFYQEEFYIRRIHSLITDFLAFMPMKVKQLKNRADEDARM
IHMSIQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPSEPLQTPTVMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGAGGSPVSWEHFFHSLLLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLEQLLQGINPRTKKADNVVNIA
RYLYHGNNNPELAFESAKILCCISCNSNIQVKMVGDFTHDQSVSQKLMAGFVECLDYEDT
EEFVRVEEGSELEKKLAAIRHETRIHILNLLITSLERNPPNLALYLLGFELKKPISTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRDGPVAVREYPQLADLCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSNKEHEISMLSQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGMEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLQGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQELIQAEDRQLIIRDLLQDVHD
KVLDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQRQPLVSGPGEAQYAFMLDSSLTSSPA
AESRPVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENMAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQHQWLLYLSNSGYLKVLVDSLVDDDRTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKEQQGSAELLRSGVIVRLAQCQVYDMRPEMDSHGMFGMRDPPVFIPTPVDRYRQIL
LPALQLCQVILTSSMSQHLQAAGQVLQFLVSHSDTIQAILRCQDVSTGSLQELALLTGII
SKAALPGMLSELDVDVNEGSLMELHGHIARFQRQCLGLLSRFGGADRLRQFKFQDNNAEG
DRVSKKDEIELAMQQICANVMEYCQSFIQQNSSNLQSAAMCLFTPSLSETVNRDGARQDT
QVPVVPYWRLPGLGIIIYLLKQSATDFFSYYDSHRRSVNKLQNVEQLPPDEIKELCQSVM
PAGIDKISTAQKCVLARRRLVKLINNRAKLLSLCSYIIETCLFILWRHLEYYLLHCTPMD
SQDSLFASRTLFKSRRLQEPNLDFRSGLSQVNQHDIDQLQSDAVNAFGESLQKKLLDIEG
LYSKVRSRYSFIQALIRRIRGLLRLSRN
NT seq 6027 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgttggcggtaaattcggctgccagcctgtggggaccctacaaagacatt
tggcagacagttggaagtgctctttggagaagacagcctgaagctgtccaccttcttgac
atgattttgaagaaacacaaacccgacttcatttcactgttcaaaaacccacccaaaaat
gttcaacagcatgagaaaattcagaaagccagttcagagggtgttgcgatccaggggcaa
caaggaaccagacttcttcctgagcagctcattaaagaagcatttatcatcagtgacctt
tttgatattggggaattgtcagctgttgagcttctccttgctggagagcatcagcagcca
catttccctggcctcaccaggggattggtagctgtccttttatactgggatggaaagcgg
tgcattgcaaattctctcagaaccctgatacagtctagacgaggaaagacatggacatta
gaactcagtccagagctggtttccatgacaacacgctttacagatgagctgatggagcaa
ggattgacttacaaagtccttactttgctgtcacagattgatgtgaataatgagtttgag
aaactacagagagagagaggtttgggcagtgagaaacaccgcaaagaggtttctgatctc
atcaaggagtgcaggcagtctctggctgaaagtctttttgcctgggcttgccagtcacca
ttacccaaagatgacaccctcctacttattggacatttggaaagagtgacagttgaggcc
aatggctccctagatgcagtgaatctgtgcctccttatggctcttctgtactgttttgat
accagctttatagaccaaagcacagaggaacgagatgatatgattcaccaccttccactg
ttgacagagagacagtacgtttcgacaattcactctcgcctccaggactctcagccttgg
aagcttcctggactgcaggccactgttaggcttgcctgggccctggcgttgagggggata
tcccagctaccggatgtaacagccctggctgagttcacagaagcagatgaagcaattgca
gagctggccattgctgataatgtcttcctgttcctcagcgaggctgttgtgctggctgaa
aacttctatcaggaagagttttacatccgcagaatccacagtcttatcacagacttcctt
gcatttatgccaatgaaagtgaaacagctgaagaatcgggcagatgaagatgctcgaatg
attcacatgagtatacagatgggtaatgaaccccccatctcacttagaagggacctggaa
cacttaatgctcctgattggtgaactgtataaaaaaaatccatttcatctggagcttgcg
ctagaatactggtgtccctcagagcctctgcagactcccacagtcatgggctcttacctg
ggagtagctcatcagcggcctcctcagcgccaggttgtcttgtcaaagtttgttagacaa
atgggtgacctgttgcctccaactatttatattccttatttgaaaatgctccagggcctg
gccaatgggcctcagtgtgcccactactgttttagcctgctcaaagtcaatggtagtagt
catgttgaaaacatacagggagcaggtggcagtcctgtttcctgggagcatttctttcat
tccttattgctctaccatgagcatctccggaaggacctgccaagtgcagacagtgtccag
taccgtcaccttccttcccgtggcatcacccagaaggagcaagatggactgattgctttt
ctccagctgacatctactatcattacttggagtgagaatgctcgcttggccctctgtgaa
catccccagtggacgcctgttgtggtgattctggggctcctgcagtgcagtattcctcca
gttctcaaagctgagctactgaagacacttgcagcttttggaaagtctcctgaaattgcc
gcttcactttggcagtcgttggaatacacacagatactgcagacagtcagggttccaagc
cagaggcaggctattggtattgaggttgaactcaatgaaatagagtcccggtgtgaagag
taccccctgactagggccttttgccagttgatcagcaccctggtggagagctcattccct
tctaatctgggtgctggcctgcgcccccctggctttgacccttacttgcagttcctgaga
gattctgtgtttctccgattccgtacaagagcttaccggagagccgctgaaaagtgggaa
gtcgctgaggttgtcttggaagtgttttataagctgttgagagattatgaacctcagctt
gaagattttgtagatcaatttgtggaactacaaggagaagaaatcatagcctataagcca
cctggctttagtctgatgtatcaccttctgaacgagtcacccatgctggagcttgccctc
agtttactggaagaaggagttaagcagcttgatacctacgctcctttccctggaaagaaa
cacctggaaaaagcagttcagcattgcctggcactgctcaacctcactctgcaaaaggag
aaccttttcatggaccttctgagagagagtcagctggctctcatcgtctcgccattggaa
cagctcttgcagggaattaatccgaggactaagaaggcagacaacgtggttaacatcgcc
aggtatctgtatcatgggaacaataatcctgagttggcatttgaaagtgcgaagatcctc
tgctgtatctcttgtaattccaacattcaggtcaaaatggttggcgatttcacacatgac
cagagtgtgagccagaagctgatggctggatttgtagagtgcttggattatgaagacacg
gaagaatttgtacgtgtagaagagggctcagaattagaaaagaagttagctgcgatccgt
catgaaacgagaatccatatcttgaatcttctcatcacatctctagaacgcaatccaccc
aatcttgctctctacctgttgggctttgagttaaagaaacccatcagtaccaccaatcta
caagacccaggagtgttaggctgccctcggacgtgcctgcatgccatcctcaacattctg
gagaagggcacagaggggagagatggccctgtggctgtgcgggagtatcctcagctggcc
gacctgtgctaccaggtgatatatcagttatgtgcatgctcagatacatctggtcctact
atgaggtacttgagaaccagccaggatttcttattttcccagttgcaacatctacctttc
tccaacaaagagcatgaaatctccatgctgagtcagatgtcatggcttatgaagacagcc
tcaatagagctaagagtgacatctctgaatcgccagcgctcacatacacagaggctcctg
cacctcttactggatgacatgccggtgaagccgtactcagatggtgaaggaggaatggaa
gatgaaaacagatctgtctctgggttccttcattttgacactgccacaaaagtgcgtcga
aaaattctaagcatccttgactcgattgacttcagtcaggagatccctgagcccttgcag
ctggatttttttgaccgtgctcagattgagcaagtcattgccaactgtgagcacaagaat
ttacaggggcagacggtctgcaatgtcaagcttcttcatagagttctcgtagctgaagtc
aatgctcttcagggtatggcagcaataggtcagaggcctctgctgatggaggaaatcagc
actattcttcagtatgttgtaggaagaaacaagctgctacagtgtcttcatgcaaagcgg
catgctctagagtcctggaggcagctggtagaaattatcctgacagcttgtcctcaggag
ctcatccaggcagaagaccgacagctcattatccgtgaccttttacaagatgtgcacgat
aaggtgctggatgatgaagccgcacaagagttaatgccagtggttgccggcgctgtgttc
accctgactgctcacctaagccaggctgtgcgcacggaacagaggcagccgttggtctca
ggacctggagaggcccagtatgctttcatgcttgatagttctttgacctcatctcctgca
gcagagagccggccagtaggctttgcgtctatcggagattcttcgcttcacatcatactg
aagaaactgttggactttattttgaagacaggtggtggcttccagcgtgtaaggactcac
ctgtacggctctctgctttattatttacagattgcccagagaccagatgagccggacaca
ctagaagctgctaagaaaactatgtgggaacggctgactgcccctgaagatgtgtttagt
aaattacaacgagagaacatggctatcattgagagttatggcgctgccctcatggaagtg
gtctgtcgagacgcttgtgatggccatgagattggaaggatgctggccctggctctcctt
gatcggattgtctctgtggacaagcagcatcagtggctcttgtacctttctaacagtggc
tatttgaaggtccttgtggatagcttggtggacgatgaccgaactctacagagcttgctg
actccgcagcctcctctcttaaaagccctttatacgtatgaatccaaaatggcatttctc
acgagagtggctaaggaacagcaaggttcagcagagctcctgagatcaggggtgattgtg
aggctggcccagtgccaagtctatgatatgcgcccagaaatggactctcatggcatgttt
ggcatgagagacccaccagtattcatcccaacgcctgtggaccgataccggcagattctc
cttccagctctccagctgtgccaggtcatcctcacatccagtatgtcccagcacttgcag
gcagcagggcaggtgctgcagtttcttgtttcacattctgataccatccaagcaatcctg
cgctgtcaggatgttagcactggctctttgcaggaattagctctgctgacaggaatcata
agtaaagcagcgcttcctggtatgttaagtgaacttgatgtagatgtaaatgaaggatcc
ttaatggagctccatggacacattgcaaggtttcagcgccagtgcttaggcctactaagt
cgctttggtggtgctgacagactgcggcagtttaaatttcaagataataatgcggaggga
gatagggtcagcaagaaagatgaaattgagctggccatgcagcagatttgtgccaatgtg
atggaatattgccagtcattcatacagcagaactcctctaacctccagagtgctgctatg
tgtctcttcaccccgagcctttcagagacagttaacagagatggagcacggcaagatacc
caggttccagtcgttccgtattggcgcctgcctggcttgggcattattatctacctgctg
aagcagagtgccactgatttctttagctactatgacagtcaccgtcgcagtgtcaacaag
ctgcagaatgtagaacaacttcctccggatgagataaaagagttatgccagtctgtgatg
cctgctggtattgataaaatctctactgcacagaagtgtgtcttagcaagacgtcgtctg
gtgaagctgatcaacaaccgtgccaaactgctgtccctctgttcctatatcatcgagacc
tgcctgtttattctttggcgccatctggagtattatttgttacattgcacgccaatggat
tcccaagattcattgtttgcctctaggactttatttaaaagcagaagactacaagaaccc
aatctggacttcagaagtggactatctcaagtgaaccagcacgatatagaccagcttcag
tctgatgctgtcaacgctttcggagagtcgctgcaaaagaaacttcttgacattgaaggg
ttgtactcaaaagttcgatcccgctatagtttcatccaggctctcatcagacgtatccgt
ggcctgctgaggctgtccaggaactga

DBGET integrated database retrieval system