KEGG   Mus musculus (mouse): 70762Help
Entry
70762             CDS       T01002                                 

Gene name
Dclk2, 6330415M09Rik, AU044875, CL2, CLICK2, Click-II, Dcamkl2
Definition
(RefSeq) doublecortin-like kinase 2 (EC:2.7.11.1)
  KO
K08805  
doublecortin-like kinase 1/2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     70762 (Dclk2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  DCAMKL family
   70762 (Dclk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F1
AA seq 756 aa AA seqDB search
MASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSISGPKGNGLIPSPAHSAHCSFYRTR
TLQALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGV
RTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNVNPNWSVNIKGGTTRTLAVA
SAKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSGV
VKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRYAQDDFVLDHSECRVLKSSYSRASAA
KYSGSRSPGFSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKQISAQGRSS
SNVNGGPELDRCLSPEGVNGNRCSESFPLLEKYRIGKVIGDGNFAVVKECVDRYTGKEFA
LKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAI
TSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLA
TVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDL
FDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWVSDDASQENNM
QAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKLCQDSSRPSREQTSPV
PPSAQEAPPPLESPRPPGPPATSGCDLAGTWRRHRD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacaaggagcattgagctggaacattttgaagaacgggacaaaaggccgcgg
ccagggtcacggagaggggctcccagctcctccgggggcagcagcatctctggccccaag
ggcaacgggctcatccccagcccggcgcacagtgctcactgcagcttctaccgcacgcgg
accttgcaggccctcagctcggagaagaaggccaagaaggcgcggttctaccggaatggg
gaccgctatttcaaaggcctggtctttgccatctccaacgaccgtttccgttccttcgat
gcgctcctcatagagctcacccgctcactgtctgacaatgtgaacctgccccagggcgtc
cgcaccatctacaccatagacggcagccggaaggtcaccagcctggacgagctgctggaa
ggtgaaagttacgtgtgtgcctccaacgaaccatttcgtaaagttgattacaccaaaaac
gttaatccgaactggtctgtgaacatcaagggcggaaccacccgcaccctggccgtggcc
tctgcgaagagtgaggtgaaagaaagcaaagacttcattaaacccaagttagtgactgtg
attcgaagcggagtgaagcctagaaaggccgtgcggatccttctgaataaaaagactgcc
cattcctttgagcaggtcttaacagatatcaccgaagccattaaactagactcaggcgtg
gtcaagaggctgtgcaccctggatggaaagcaggttacttgtctgcaagacttttttgga
gacgatgatgtttttattgcatgtggacctgaaaaatatcgttatgcccaagatgacttt
gtcctggatcatagcgaatgccgtgtcctgaaatcgtcctactctcgagcctcagctgcg
aagtattctggatccagaagcccagggttctcccgccgcagcaagtcaccagcttcagtg
aatggaactcccagtagccagctttccactccgaagtccaccaagtcctccagctcctct
ccaaccagcccgggaagtttcagaggattgaagcagatttctgctcagggcagatcttct
tccaacgtaaacggtgggcctgaacttgaccgttgcctgagccctgaaggtgtgaatgga
aaccggtgctccgagtcgttcccccttctggagaaatacagaatagggaaggtcatcggg
gacggcaacttcgcggtagttaaggagtgcgtggacaggtacactggaaaagagtttgca
ttaaagattatagacaaagccaaatgctgtggaaaggagcatctgattgagaacgaagtg
tcaatcctgcgccgagtgaagcaccccaacatcatcatgttggttgaagagatggaaaca
gcaactgacctctttctagtgatggaactggtcaaaggtggagatctctttgatgcgatt
acctcttcaaccaagtacactgagagagatggaagcgccatggtgtacaacctagccaat
gccctccggtacctgcacagcctcagcatcgtccacagggacatcaagcctgagaatctg
ctggtgtgcgaatacccagatggaaccaagtctttgaagctgggagactttgggctggcg
acggtggttgaaggcccgttgtacacggtctgtggcacgccaacttatgtggcaccagag
atcatagctgaaacaggttatggcctgaaggtggatgtttgggcagctggtgtgattaca
tacatacttctctgtggattcccaccattccggagtgagaacaatctccaggaagatctc
tttgaccagatcttggctggaaagctggaattcccagccccctactgggacaacattaca
gactctgccaaggagttaatcagtcaaatgcttcaggtaaacgttgaagctcgctgtact
gcgggagaaattctgagtcacccctgggtgtcagatgatgcatcccaggagaacaatatg
caagccgaggttacaggtaaactaaaacagcactttaataatgcgctccccaaacagaac
agcaccaccaccggggtctccgttatcatgaacacggctctagataaagaggggcagatt
ttctgcagcaagctctgtcaagacagcagcagaccatccagggagcagacctcgccagtc
cctccctcagcccaggaggcccctcccccactggagtctcccaggccccctggtcctcca
gccacctctggctgtgatctggcagggacctggcgccgccaccgagactga

DBGET integrated database retrieval system