KEGG   Mus musculus (mouse): 70839Help
Entry
70839             CDS       T01002                                 

Gene name
P2ry12, 2900079B22Rik, 4921504D23Rik, P2Y12
Definition
(RefSeq) purinergic receptor P2Y, G-protein coupled 12
  KO
K04298  
purinergic receptor P2Y, G protein-coupled, 12
Organism
mmu  Mus musculus (mouse)
Pathway
Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04611 Platelet activation
    70839 (P2ry12)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    70839 (P2ry12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 D
AA seq 347 aa AA seqDB search
MDVPGVNTTSANTTFSPGTSTLCVRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIR
SKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTLVCQVTSVTFYFTMYISISF
LGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDKDVTK
CSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKVPKKKV
NVKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCSAENTLFYVKESTLWLTSLNACLD
PFIYFFLCKSFRNSLTSMLRCSNSTSTSGTNKKKGQEGGEPSEETPM
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcctggtgtcaacaccacctcagccaataccaccttctcccctgggaccagc
accctgtgcgtcagagactacaagatcacccaggttctcttcccattgctgtacaccgtc
ctgttctttgctgggctcatcacgaacagcttggcaatgaggattttctttcagatccgc
agtaaatccaacttcatcatttttcttaagaacacggtcatctctgatctactaatgatt
ctaacttttccatttaaaattcttagtgatgctaaactgggagccgggcctctgagaacc
ttggtgtgccaagttacttcagtcacattttattttacaatgtatatcagtatatcgttc
ctggggttgataaccattgaccgctacctgaagaccaccaggccatttaaaacgtccagc
cccagcaatctcttgggtgcaaagattctttctgttgtcatctgggccttcatgttctta
atttcactgcctaacatgattctcaccaacaggaggccaaaagataaggacgtaacaaaa
tgttctttcttaaagtcagagtttggtctagtttggcacgaaatagtcaattacatctgc
caagtcattttctggattaattttttaattgtcatcgtttgttatagcctcattaccaaa
gaactctatcggtcttatgtcagaacaaggggttcagccaaagttcccaagaaaaaggta
aacgtcaaggttttcatcatcattgctgtattctttatttgctttgttcccttccacttt
gcacggattccctacaccctgagccaaactcgggccgtctttgactgcagtgctgagaac
accctgttctacgtgaaggagagcaccctatggctgacgtcactgaacgcctgccttgat
ccattcatctacttttttctttgcaagtctttcagaaattccttgacaagcatgctgagg
tgctcaaactctacatcaacatctgggacaaacaagaagaaaggacaagaaggtggcgaa
ccaagcgaagagaccccaatgtag

DBGET integrated database retrieval system