KEGG   Mus musculus (mouse): 71336Help
Entry
71336             CDS       T01002                                 

Gene name
Rbks, 5230400M11Rik, AI326806, RBSK, RK
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    71336 (Rbks)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     71336 (Rbks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin RE_EcoO109I Fapy_DNA_glyco
Motif
Other DBs
NCBI-GeneID: 71336
NCBI-ProteinID: NP_694876
MGI: 1918586
Ensembl: ENSMUSG00000029136
Vega: OTTMUSG00000028317
UniProt: Q8R1Q9
Position
5; 5 B1
AA seq 323 aa AA seqDB search
MAACGEPGRPWQEEEAAAVVVVGSCMTDLVSLTSRLPKTGETIHGHEFFIGFGGKGANQC
VQAARLGAKAAIVCKVGNDSFGNDYIENLKQNHISTEFTYQTRDAATGTASIIVNNEGQN
IIVIVAGANLFLNSEDLKKAASVISRAKVMICQLEISPAASLEALTMARRSGVKTLFNPA
PAMADLDPQFYTLSSIFCCNESEAEILTGHAVSDPTTAGKAAMILLERGCQVVVITLGAS
GCVILSQAEPVPKHIPTEAVKAVDTTGAGDSFVGALAFYLAYYPNLSLEEMLKRSNFIAA
VSVQATGTQSSYPYKKDLPLALF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtgtggggagcccgggaggccctggcaggaggaggaggcagcagcggtggta
gtggtgggttcctgcatgaccgacctggtcagtcttacttctcgcttgccaaaaactgga
gaaaccatccatggacatgagttttttattggctttggaggaaaaggtgccaaccagtgt
gtccaagctgcgcgactgggagcaaaggcggccatagtctgcaaggttggcaacgattct
tttggcaatgattacatagaaaacttaaaacaaaatcatatttctacagagtttacatat
cagaccagagatgcagctacaggaacagcctccataattgtcaataatgaaggccagaat
atcatcgtcatagtggctggagcaaatctgtttttgaattctgaagacttgaagaaggca
gccagtgtcattagccgagccaaagtgatgatatgccagctagaaataagcccggcagct
tctctggaagctctgacaatggcccgcaggagtggagtgaaaaccttgttcaacccagct
ccagccatggctgacctggacccccagttctataccctctccagtattttctgctgcaac
gagagcgaggctgagattttaacaggccacgcagtgagtgaccccaccacggctgggaag
gctgcaatgattctcctagaacggggctgccaggttgtggtcatcaccttaggggcttca
ggatgcgtgatactgtcacaggctgagcctgttccaaagcacattcccactgaagctgtc
aaggctgtagacaccacgggtgctggtgacagttttgtgggagcgctggccttctacctg
gcttactacccaaatctgtccttggaagaaatgctcaagagatccaatttcatcgctgca
gtcagtgtacaggccacgggaacacagtcctcttatccatacaaaaaagacctccctctt
gctctattttga

DBGET integrated database retrieval system