KEGG   Mus musculus (mouse): 71336Help
Entry
71336             CDS       T01002                                 

Gene name
Rbks, 5230400M11Rik, AI326806, RBSK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    71336 (Rbks)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     71336 (Rbks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 B1; 5
AA seq 323 aa AA seqDB search
MAACGEPGRPWQEEEAAAVVVVGSCMTDLVSLTSRLPKTGETIHGHEFFIGFGGKGANQC
VQAARLGAKAAIVCKVGNDSFGNDYIENLKQNHISTEFTYQTRDAATGTASIIVNNEGQN
IIVIVAGANLFLNSEDLKKAASVISRAKVMICQLEISPAASLEALTMARRSGVKTLFNPA
PAMADLDPQFYTLSSIFCCNESEAEILTGHAVSDPTTAGKAAMILLERGCQVVVITLGAS
GCVILSQAEPVPKHIPTEAVKAVDTTGAGDSFVGALAFYLAYYPNLSLEEMLKRSNFIAA
VSVQATGTQSSYPYKKDLPLALF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtgtggggagcccgggaggccctggcaggaggaggaggcagcagcggtggta
gtggtgggttcctgcatgaccgacctggtcagtcttacttctcgcttgccaaaaactgga
gaaaccatccatggacatgagttttttattggctttggaggaaaaggtgccaaccagtgt
gtccaagctgcgcgactgggagcaaaggcggccatagtctgcaaggttggcaacgattct
tttggcaatgattacatagaaaacttaaaacaaaatcatatttctacagagtttacatat
cagaccagagatgcagctacaggaacagcctccataattgtcaataatgaaggccagaat
atcatcgtcatagtggctggagcaaatctgtttttgaattctgaagacttgaagaaggca
gccagtgtcattagccgagccaaagtgatgatatgccagctagaaataagcccggcagct
tctctggaagctctgacaatggcccgcaggagtggagtgaaaaccttgttcaacccagct
ccagccatggctgacctggacccccagttctataccctctccagtattttctgctgcaac
gagagcgaggctgagattttaacaggccacgcagtgagtgaccccaccacggctgggaag
gctgcaatgattctcctagaacggggctgccaggttgtggtcatcaccttaggggcttca
ggatgcgtgatactgtcacaggctgagcctgttccaaagcacattcccactgaagctgtc
aaggctgtagacaccacgggtgctggtgacagttttgtgggagcgctggccttctacctg
gcttactacccaaatctgtccttggaagaaatgctcaagagatccaatttcatcgctgca
gtcagtgtacaggccacgggaacacagtcctcttatccatacaaaaaagacctccctctt
gctctattttga

DBGET integrated database retrieval system