KEGG   Mus musculus (mouse): 71472Help
Entry
71472             CDS       T01002                                 

Gene name
Usp19, 8430421I07Rik, AI047774, Zmynd9
Definition
ubiquitin specific peptidase 19 (EC:3.4.19.12)
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     71472 (Usp19)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   71472 (Usp19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 F2; 9
AA seq 1324 aa AA seqDB search
MSAGASATGPRRGPPGLEEATSKKKQKDRANLESKDGDARRVSLPRKEPTKDELLLDWRQ
SADEVIVKLRVGTGPVRLEDVDAAFTDTDCVVRLPDGRQWGGVFFAEIQSSCTKVQARKG
GLLQLVLPKKVPLLTWPSLLKKPLGTQELVPGLQCQENGQELSPIALEPGSEPRRAKQEA
RNQKRAQGRGEVGSGAGPGTQAGPSAKRAVHLRRGPEGEGSMDGPGPQGDAPSFLSDSAT
QVEAEEKLCAPPMNTQTSLLSSEKSLALLTVEKTVSPRNDPVAPVMVQDRDPEPEQEDQV
KEEMALGADPTALVEEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEIRRDSSRVLFREQD
FTLIFQTRDGNFLRLHPGCGPHTIFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQR
WGGLEAPATRGAVGGAKVAVPTGPTPLDSTPPGGGPHPLTGQEEARAVEKEKPKARSEDS
GLDGVVARTPLEHVAPKPDPHLASPKPTCMVPPMPHSPVSGDSVEEDEEEEKKVCLPGFT
GLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLRAL
WKGTHQAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVD
SDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLP
QKQKVLPIFYFAREPHSKPIKFLVSVSKENSSASEVLDSLSQSVHVKPENLRLAEVIKNR
FHRVFLPSHSLDAVSPTDVLLCFELLSPELAKERVVVLEVQQRPQVPSIPISKCAACQRK
QQSEEEKLKRCTRCYRVGYCNQFCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYARLA
QLLEGYARYSVSVFQPPFQPGRMALESQSPGCTTLLSTSSLEAGDSEREPIQPSELQLVT
PVAEGDTGAHRVWPPADRGPVPSTSGLSSEMLASGPIEGCPLLAGERVSRPEAAVPGYQH
SSESVNTHTPQFFIYKIDASNREQRLEDKGETPLELGDDCSLALVWRNNERLQEFVLVAS
KELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLW
RLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINH
YGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSP
VERPPRASHSEHHPDLGPAAEAAASQGLGPGQAPEVAPTRTAPERFAPPVDRPAPTYSNM
EEVD
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaggggccagtgctacagggcccaggagggggccgccaggactggaagaggcc
actagtaagaagaaacagaaggatcgagcaaacctggaaagtaaagatggagatgctagg
agagtgtcccttcctcgaaaggaaccaaccaaagatgaattgttgctcgattggaggcag
agtgcagatgaggtgattgttaagctgcgcgtgggaacaggtcccgtacgtctggaggat
gtagatgctgcgttcacagacacggactgtgtggtgaggcttccagatggtcggcagtgg
ggtggtgtcttctttgctgaaatacaaagttcttgcaccaaagtgcaggctcgcaagggt
ggtcttctacagctagtactacccaagaaggtgcctctgctcacgtggccctctctcctg
aagaaacctctgggaacccaagagctggtgccaggtttgcagtgccaggagaacgggcaa
gagctgtctcccattgccctggagccaggctctgagccccgcagagctaaacaggaagcc
cgaaaccagaagcgggcccagggccgtggtgaggtaggctcgggggctggccctgggaca
caggcagggcccagcgccaagagggctgttcacctccgcagagggccagaaggggaaggg
tccatggatggccccggcccccagggtgatgccccgtctttcctgtctgactcagctacc
caggttgaggctgaggagaagctctgtgctccaccaatgaacactcaaacaagtctcttg
agctcagagaagagtttagcccttctgacagtagagaagacagtgtcccccaggaatgac
ccagtcgccccggttatggtccaggacagagaccctgagcctgagcaagaagaccaagtc
aaagaggagatggcacttggggctgatcctacagccttggtggaggaaccagagtctatg
gtgaacctggcatttgtcaagaacgactcgtatgagaagggcccggattcggtggtggtg
cacgtgtacgtgaaggagatccgcagggacagctcccgagtgctcttccgagagcaggac
ttcacactgatcttccagaccagggacggaaactttctgaggctgcatccgggctgtggg
ccccacaccatcttccgatggcaggtgaagctcagaaacttgattgaaccagagcagtgt
acgttctgtttcacggcctctcgaatcgatatctgcctccggaagcggcagagtcagcgc
tgggggggactggaggcccctgctacacgaggtgcagtgggtggtgcaaaggttgccgtg
ccgacaggcccaacccctttggattcaacccctccaggaggtggcccccaccccctgaca
ggccaggaggaagccagggctgtggagaaggaaaaacccaaggctcgatcagaggactca
gggctggatggtgtggtggcccgcacccccttggagcatgtagccccaaagccagaccca
cacttggcctcgcccaaacccacgtgtatggtgcctccaatgccgcacagtccagttagt
ggggatagtgtggaggaggacgaagaggaagagaagaaggtgtgcctgccaggcttcact
ggccttgtcaacttagggaacacctgcttcatgaatagcgtcattcagtctttgtccaac
actcgggaacttcgtgacttctttcacgaccgatcctttgaagctgagattaactacaat
aacccattggggactggtgggcgcctcgccattggctttgctgtgctgctccgggcccta
tggaagggtactcaccaagcctttcagccctccaagctaaaggccattgtggcaagcaag
gccagccagttcacaggctatgcacagcatgatgctcaagagttcatggctttcttgttg
gatgggctacatgaagacctcaatcgaatccaaaacaaaccctacacagagactgtggac
tcggacgggcggcccgatgaggtggtagccgaggaagcatggcagcggcacaagatgaga
aatgattcattcattgtggacctgtttcagggccagtacaagtcaaagctggtgtgccct
gtgtgtgccaaggtctccatcacttttgacccgttcctttatctgccggtacccttgcca
caaaagcaaaaggttctccccatattttattttgccagggagccccacagcaagcccatc
aagttcctggtgagtgtcagcaaggagaactccagcgcgagtgaagtgttggactccctc
tctcagagtgtccacgtgaagcctgagaacctgcgcctagccgaggtaattaagaaccgt
ttccaccgtgttttcttgccctcccactcactggacgctgtgtcccccacggacgtgctc
ctctgctttgagctgctctccccagaactggctaaggagcgggtagtagtgctggaggtg
cagcagcgcccccaggtacccagcatccctatctccaagtgcgcagcctgccagcggaag
cagcaatcagaagaagaaaagctgaagcgctgtacccgttgctaccgtgtgggctactgc
aaccagttctgccagaaaacccattggcctgaccacaaaggcctctgccgccctgagaac
attggctaccccttcctggtcagtgtgcctgcttcacgcctcacttatgcccgtcttgct
cagctactagaaggttatgcccggtactctgtgagtgtattccaaccgcccttccagcct
ggccgcatggctttggaatcgcagagccctggctgtaccacgttgctttcaaccagctct
ctggaggctggggacagtgaaagagaacccattcagccttctgagctccagctggtgacc
cctgtggctgaaggggatacaggggctcaccgagtatggccgcctgctgataggggtcct
gtgcctagcaccagtggactctcttctgagatgctggccagtgggcctatcgaaggttgt
cccttgcttgctggtgagagggtatctcggcctgaagctgctgtgcctgggtaccaacac
tcaagtgaatctgtgaatacccacacgccccagttcttcatctataaaattgatgcatca
aaccgtgagcagcggctggaggacaaaggggagacaccattggagctaggtgatgactgt
agcctggctctggtgtggcggaacaatgaacgcctgcaggagtttgtgttggtagcctcc
aaggagctggaatgtgctgaagatccaggctctgctggtgaggctgcccgtgctggccac
ttcaccctggaccagtgcctcaacctctttacacggcctgaagtgctggcacctgaggag
gcctggtactgcccacagtgcaaacagcatcgtgaggcctccaaacagctgctgttgtgg
cgcctaccgaacgtgctgattgtgcagctcaagcgcttctcctttcgtagtttcatttgg
cgagacaagatcaatgacttggtggagtttcctgttcggaacctggacttgagcaagttc
tgtatcggtcagaaagaggagcagctgcctagctatgacctgtatgctgtcatcaaccac
tacggaggcatgatcggtggccactatactgcttgtgcacggctgcccaatgatcgcagt
agccagcgcagtgacgtgggctggcgcttgtttgatgacagcacggtgacaacagtagac
gaaagccaggtcgtgacgcgctatgcctatgttctcttctaccgtcgtcggaactctcct
gtggagagaccccccagggcaagtcactctgaacaccacccagacctaggccctgcagct
gaggctgctgccagccagggactaggccctggccaggcccccgaggtggcccccacgcgg
acagcccctgaacgcttcgccccccctgtggaccgcccagcccccacgtacagcaacatg
gaggaggtcgattag

DBGET integrated database retrieval system