KEGG   Mus musculus (mouse): 71609Help
Entry
71609             CDS       T01002                                 

Gene name
Tradd, 9130005N23Rik, AA930854
Definition
(RefSeq) TNFRSF1A-associated via death domain
  KO
K03171  
tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Sphingolipid signaling pathway
Apoptosis
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Tuberculosis
Hepatitis C
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    71609 (Tradd)
   04668 TNF signaling pathway
    71609 (Tradd)
   04071 Sphingolipid signaling pathway
    71609 (Tradd)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    71609 (Tradd)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    71609 (Tradd)
  Endocrine system
   04920 Adipocytokine signaling pathway
    71609 (Tradd)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    71609 (Tradd)
  Infectious diseases
   05152 Tuberculosis
    71609 (Tradd)
   05160 Hepatitis C
    71609 (Tradd)
   05169 Epstein-Barr virus infection
    71609 (Tradd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 D3; 8 53.04 cM
AA seq 310 aa AA seqDB search
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQ
ILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGS
KFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPDGGLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagccggtcagaatggccacgaggagtgggtgggcagtgcatacctgtttttggag
tctgcggtagacaaggtgatcctgtctgaagcctacacggatcccaagaagaaggtggca
atatacaaggctctgcagactgcactgtcagagagtggggacagctctgacgtactgcag
atactcaagatccactgcagcgaccctcagctcatcgtccagttgcggttctgcgggcgc
gtgctgtgcggccgcttcctccaagcctaccgcgagggggcgctgcgcaccgcgctgcag
aggtgcatggccccggcgcttgcccaggaagcgctgcggttgcagctggagttgcgtgca
ggtgcggagcagctggacagttggctgactgatgaagagcgctgtttgaattacatctta
gcccagaagcccgaccggctcagggacgaggaactcgcggagctggaggatgagctctgc
aaactgacgtgtgactgcactggccagggtggagccatacaggtagcttctgcaggttcg
aagttcccggtttcctctccgaccgaggagaaaccactgccggccgcctgccagactttt
ctgttccacgggcagctcgtagtgaaccggccactgactcttcaagaccagcagacgttt
gcgcgctcggtgggtctcaagtggcgcagggtggggcgctcgctgcagcgtaactgtcgg
gcactgagagatcctgccctcgactcgctggcctacgagtatgagcgtgatgggctatac
gagcaggccttccagctgctgcgccgtttcatgcaagccgagggccgccgtgccacactg
cagcgcctggtggaggcgctggaggagaacgaactcactagtctagcagaggatctgttg
ggccaggcggagccggatggcggcctggcctaa

DBGET integrated database retrieval system