KEGG   Mus musculus (mouse): 71724Help
Entry
71724             CDS       T01002                                 

Gene name
Aox3, 1200011D03Rik, AI326299, Aoh1, Aoh2
Definition
aldehyde oxidase 3 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    71724 (Aox3)
   00350 Tyrosine metabolism
    71724 (Aox3)
   00380 Tryptophan metabolism
    71724 (Aox3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    71724 (Aox3)
   00760 Nicotinate and nicotinamide metabolism
    71724 (Aox3)
   00830 Retinol metabolism
    71724 (Aox3)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    71724 (Aox3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     71724 (Aox3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 C1.3; 1 28.96 cM
AA seq 1335 aa AA seqDB search
MSPSKESDELIFFVNGKKVTERNADPEVNLLFYLRKVIRLTGTKYGCGGGDCGACTVMIS
RYDPISKRISHFSATACLVPICSLHGAAVTTVEGIGSTKTRIHPVQERIAKGHGTQCGFC
TPGMVMSIYTLLRNHPEPSTEQIMETLGGNLCRCTGYRPIVESAKSFCPSSTCCQMNGEG
KCCLDEEKNEPERKNSVCTKLYEKKEFQPLDPTQELIFPPELMRMAEESQNTVLTFRGER
TTWIAPGTLNDLLELKMKHPSAPLVIGNTYLGLHMKFTDVSYPIIISPARILELFVVTNT
KQGLTLGAGLSLTQVKNVLSDVVSRLPKEKTQIYCALLKQLKTLAGQQIRNVASLGGHII
SRLPTSDLNPILGIGNCILNVASTEGIQQIPLNDHFLAGVPDAILKPEQVLISVFVPRSS
KWEFVSAFRQAPRQQNAFATVNAGMKVVFKEDTNTITDLGILYGGIGATVISADKSCRQL
IGRCWDEEMLDDAGKMICEEVSLLMAAPGGMEEYRKTLAISFLFMFYLDVLKQLKTRDPH
KYPDISQKLLHILEDFPLTMPYGMQSFQDVDFQQPLQDPIGRPIMHQSGIKHATGEAVFC
DDMSVLPGELFLAVVTSSKSHAKIISLDASEALASLGVVDVVTARDVPGDNGREEESLYA
QDEVICVGQIVCAVAADSYAHAQQAAKKVKIVYQDIEPMIVTVQDALQYESFIGPERKLE
QGNVEEAFQCADQILEGEVHLGGQEHFYMETQSVRVVPKGEDKEMDIYVSSQDAAFTQEM
VARTLGIPKNRINCHVKRVGGAFGGKASKPGLLASVAAVAAQKTGRPIRFILERRDDMLI
TGGRHPLLGKYKIGFMNNGKIKAADIQLYINGGCTPDDSELVIEYALLKLENAYKIPNLR
VRGRVCKTNLPSNTAFRGFGFPQGAFVTETCMSAVAAKCRLPPEKVRELNMYRTIDRTIH
NQEFDPTNLLQCWEACVENSSYYNRKKAVDEFNQQRFWKKRGIAIIPMKFSVGFPKTFYY
QAAALVQIYTDGSVLVAHGGVELGQGINTKMIQVASRELKIPMSYIHLDEMSTVTVPNTV
TTGASTGADVNGRAVQNACQILMKRLEPIIKQNPSGTWEEWVKEAFVQSISLSATGYFRG
YQADMDWEKGEGDIFPYFVFGAACSEVEIDCLTGAHKNIRTDIVMDGSFSINPAVDIGQI
EGAFVQGLGLYTLEELKYSPEGVLYTRGPHQYKIASVTDIPEEFHVSLLTPTPNPKAIYS
SKGLGEAGTFLGCSVFFAIAAAVAAAREERGLSPIWAINSPATAEVIRMACEDQFTNLVP
QTDSKCCKPWSIPVA
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atgtctccttctaaggagtcagatgagcttattttctttgtgaatggaaaaaaggtcacc
gagaggaatgcagaccctgaggttaatttattgttctacttgagaaaagtcatccgactc
acagggacaaagtatggctgtggaggaggtgactgtggcgcctgcacagtgatgatctca
agatacgaccccatctccaaaaggatcagtcatttctctgccactgcctgcctggttccc
atctgctctctccatggggctgctgtcactacagtagaaggcataggaagcaccaaaacc
aggatacaccctgtccaggaaaggattgccaaaggccatggtacccagtgtgggttctgc
actcccgggatggtgatgagcatctatactctcctgaggaaccacccagagccctccaca
gaacagataatggaaaccctgggcgggaatctatgccgctgcactggatacaggcccatt
gtggagagtgcgaaaagtttctgcccgagttcaacttgctgccagatgaatggggaaggg
aaatgttgcttggatgaagaaaaaaacgagcctgagagaaaaaacagtgtttgcaccaag
ttgtatgaaaaaaaagaatttcagcccttggatccaactcaggagcttatatttccacct
gagctgatgaggatggccgaggagtcccaaaatacagttctgacttttcgtggggaaagg
actacctggattgccccaggaaccctaaatgaccttctggaactgaaaatgaagcatccc
agcgctccacttgtgattggcaacacctatctggggcttcatatgaagttcacagacgta
tcttatccaattatcatctctcctgcaaggatcttagaattatttgtggtgactaataca
aagcaagggctgacactgggcgcaggcctcagcctgacccaggtgaagaacgtcttgtct
gacgtggtctccagactccctaaggagaagacgcagatatactgtgctctcctgaagcag
ctgaagaccctggctgggcagcagatcaggaatgtggcctccttaggtggtcatattatc
agtagactgccgacctctgacctcaaccctattttgggcataggcaattgcatcctcaat
gttgcctcaacagaaggaatacagcaaatccctctgaatgatcattttctcgctggagtt
ccagatgcaatcctgaagccagagcaagtgctcatctccgtttttgtgccacgctccagc
aagtgggagtttgtatcagccttcagacaggcccctcgtcagcaaaacgcgtttgcaaca
gtgaatgctggaatgaaagtcgttttcaaggaggacacaaacaccattacagacttgggg
atcttatatggagggattggtgccaccgtaatcagcgcagataagtcctgccggcagctg
attggaaggtgctgggatgaagaaatgctggatgatgctggcaagatgatttgtgaggaa
gtctccctcctgatggcagcccctggagggatggaggaataccgaaagactcttgccatc
agtttcctcttcatgttttacttagacgtgttgaagcagttaaagacgagggacccccac
aagtaccctgacatctcacagaaactcctacacattctggaagacttccctttaaccatg
ccttatgggatgcagtcatttcaggatgtagacttccaacagcctctgcaagacccaatc
ggacgtcccatcatgcatcagtctggcattaaacacgccacaggagaggcagtattttgt
gatgatatgtctgtgttgcctggggaactcttcttggcagtggtaaccagcagcaagtca
catgctaaaatcatctctcttgatgcctccgaggccttggcgtcacttggtgtggttgat
gtggtaacagctcgagatgtgcctggtgacaatggcagagaagaggaaagcctatatgca
caggatgaggtgatctgcgtgggtcaaattgtgtgtgctgtggccgctgactcttatgct
catgcccagcaggccgcaaaaaaagtgaagattgtctatcaagacatagagcccatgatt
gtgacagtgcaggatgcactgcaatatgaatcattcattggacctgaaagaaaactagaa
caaggaaatgttgaggaagcatttcaatgtgccgatcaaatcctcgaaggggaggtgcac
ttgggaggccaggagcatttttacatggagactcaaagcgtacgtgtggtccccaaggga
gaggataaggagatggacatctatgtgtcaagccaggatgctgcatttacacaggaaatg
gtggctcgcaccttgggcatcccaaagaataggatcaactgccatgtgaaaagggttggt
ggagccttcggagggaaagcaagcaagcctgggctcctggcatccgtggcagctgtagcc
gcacagaagaccggccgcccaatacgtttcattctagagcgtagggatgacatgttgata
actggaggacgtcacccactactcgggaaatacaagattggcttcatgaacaatgggaaa
atcaaggcggcagacatccagctttatatcaatggaggctgcaccccagatgattctgaa
ctggtgatagaatatgctttgctcaaactggaaaatgcttacaagatccccaacctccgt
gtccgaggtcgagtctgtaagaccaacttgccttccaatacagcgtttcgaggatttggc
tttccccagggggcatttgtaacagaaacctgtatgtccgctgtggcagccaaatgccgc
ttaccaccagagaaggttcgagagctaaacatgtacagaacaatcgataggacaattcac
aaccaagagtttgacccaacgaatctgctacagtgctgggaggcatgtgtggaaaattct
tcctactataacaggaaaaaagctgtggatgaatttaaccaacagagattttggaagaag
agaggaattgccatcatccccatgaaattctcagttggatttccaaagacattttattat
caggctgccgctttggtccagatctacacagatgggtctgtactagttgctcatggtggt
gttgaactgggacaaggtattaacaccaaaatgatacaggtggccagccgtgaattaaag
atacctatgtcttatatacacctggatgagatgagcactgtgaccgtccccaacacggtt
accactggagcatccaccggtgccgatgtcaacgggagagctgttcagaatgcctgtcag
atccttatgaagcgtctggaacccatcatcaagcagaatcctagtggtacctgggaagaa
tgggttaaggaagcttttgttcaaagcattagcctctcggccactggatattttaggggt
taccaagctgacatggactgggagaagggagaaggtgacatttttccctattttgttttt
ggagctgcctgttctgaggttgaaattgattgtctgacgggagctcacaagaacattaga
accgacattgttatggatggatcattcagtataaatcctgctgtggacataggccagatt
gaaggggcatttgttcaaggtcttggactgtatactctagaggaactgaaatattcacct
gaaggagtcctatacactcgtggtccacaccagtacaaaatagcatcagttaccgacatc
ccagaagaattccatgtatcactgttgacaccaaccccaaacccaaaagccatctactct
tctaagggccttggcgaagctggaacgtttctgggctgttctgtgttcttcgctattgcc
gcggccgtggctgcagctcgagaggagagaggcttgtccccaatttgggccataaacagc
cctgccacagcagaagtgatccgcatggcctgtgaggaccagttcacgaacctggttcca
caaacggattctaaatgctgtaagccgtggtccatcccagttgcctag

DBGET integrated database retrieval system