KEGG   Mus musculus (mouse): 71726Help
Entry
71726             CDS       T01002                                 

Gene name
Smug1, 1200013B09Rik, A930006H09Rik, C85220
Definition
single-strand selective monofunctional uracil DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
mmu  Mus musculus (mouse)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    71726 (Smug1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     71726 (Smug1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
15 F3; 15
AA seq 279 aa AA seqDB search
MAASQTFPLGPTHEPASALMEPLPCTRSLAEGFLEEELRLNAELSQLQFPEPVGVIYNPV
DYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGVGGPVLTPP
QEHPKRPVLGLECPQSEVSGARFWGFFRTLCGQPQVFFRHCFVHNLCPLLFLAPSGRNLT
PAELPAKQREQLLSICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLTPEVQVEGLL
HPSPRSAQANKGWEAAARERLQELGLLPLLTDEGSARPT
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtcccagaccttcccactggggcctacccatgagcctgcaagcgccctgatg
gagcctctgccttgtacacgaagcttggctgagggcttcctggaggaggagcttcggctc
aatgccgagctgagccagctgcagttcccggagcccgtgggtgtcatctacaacccggtg
gattatgcttgggagccacaccgtaactatgtgactcgctactgccaaggccccaaggaa
gtgctgttcttgggcatgaacccaggaccttttggcatggcccaaacaggggtacccttt
ggggaagtgaatgtggtccgggactggttgggcgttgggggccctgtgctgacccctcca
caagagcaccccaagcgaccagtgttgggactggagtgcccacagtcagaggtgagcgga
gcccgattctggggctttttccggaccctctgcggacagcctcaagtcttcttccggcac
tgctttgtccacaatctgtgtcctctactcttcttggctcccagtggacgaaaccttacc
ccagctgagctgcccgccaagcagcgggagcagctgctgtcgatctgcgacgcagccctc
tgccggcaggtgcagctgctaggggtgcgtctggtagtgggagtggggcggctggcagag
cagcgagcccgaagagctctagcagggctgaccccggaggtgcaggtggaggggctcctg
catccatctcctcgaagcgcacaggccaacaaaggctgggaggcggcagccagggaaaga
ctccaggagttggggctgctgcctctgctaacggatgagggttcagccagacctacatag

DBGET integrated database retrieval system