KEGG   Mus musculus (mouse): 71770Help
Entry
71770             CDS       T01002                                 

Gene name
Ap2b1, 1300012O03Rik, AI788979
Definition
(RefSeq) adaptor-related protein complex 2, beta 1 subunit
  KO
K11825  
AP-2 complex subunit beta-1
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    71770 (Ap2b1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    71770 (Ap2b1)
  Nervous system
   04721 Synaptic vesicle cycle
    71770 (Ap2b1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    71770 (Ap2b1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    71770 (Ap2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B5
AA seq 937 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTTTNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKA
KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ
SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT
WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWIL
AELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataagaagggagaaatttttgaattaaaagct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggacgtgagctctctcttcccagatgtggtgaactgcatgcagact
gacaacctggaactaaagaagctcgtgtacctctatctgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggattgtgaagatcccaatcct
ttgattcgagccttggcagttagaaccatgggatgcatccgggtggacaagattacagag
tatctctgtgaacccctccgcaagtgcttgaaggatgaagacccctatgttcggaaaacg
gcagcagtatgcgtggcaaaactccatgatatcaatgcccagatggtggaagatcaggga
tttctggattctctgcgggatctcatagcagattcaaacccaatggtggtggctaatgct
gtagcagcattgtctgagatcagtgagtctcacccaaacagcaacttacttgatctgaac
cctcagaatatcaataagctgctcacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgaccgggaagctcagagcatc
tgtgagcgagtaacgcctcggctctcccacgccaactctgcagtggtgctttcagccgta
aaagtcctaatgaagtttctagaattgttgcccaaggactctgactactacaatatgctg
ctaaagaagttagcacctccacttgtcacgttgctgtctggggagccagaagtacagtac
gtcgccctgaggaacatcaacctaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaggtcttctttgtgaagtacaatgatcctatctatgttaaactagagaagttagac
atcatgattcgtcttgcatcccaagccaacattgctcaggttctggcggagctgaaggaa
tatgccactgaagttgatgtggactttgttcgcaaagctgtgagggccattggacggtgt
gccatcaaagtggagcaatcagcagaacgctgtgtaagcacactgcttgatctaatccag
accaaagtaaattatgtggtccaagaggcaattgttgtcatcagggacatcttccgaaaa
taccccaacaagtatgaaagtattattgccaccctctgtgaaaacttggactccctggat
gaacccgatgcccgagcagctatgatttggattgtaggagaatatgctgaaagaatcgat
aacgcagatgaattactagagagtttcctggaaggttttcatgacgaaagcacccaggtg
cagctcacactgctcaccgccatagtgaagctgtttctcaagaagccatcagaaacacag
gagctggtccaacaggtcttgagcttagccacacaggactccgataaccctgaccttcga
gatcggggttatatatattggcgccttctttcaactgaccctgtgacagccaaagaagtg
gtgttgtctgagaagccattgatctctgaggagacagacctcattgagcctaccctcctg
gatgagctcatctgccacattggttctttggcctctgtgtaccacaaacctccaaatgct
tttgtggaagggagtcatgggattcatcgcaaacacttgccaattcatcatgggagcact
gatgcaggtgatagccccgttggcaccaccactacaaccaacctggagcagcctcaggtc
attccctctcaaggtgaccttctgggggatcttttgaatcttgacctgggtcccccagtg
aatgtcccgcaagtgtcctccatgcagatgggagcggtggatcttttaggaggaggactg
gatagcctggtaggacagtccttcatcccgtcatcagtgcctgcgaccttcgctccttca
cctactcctgctgtggtcagcagtggtctgaatgacctgtttgagctttccactgggata
ggcatggcacctggcggatatgtggctcctaaggcggtctggctacctgcagtaaaggct
aaaggcttggagatttcggggacgtttactcaccgccaagggcatatctatatggaaatg
aacttcaccaacaaagctctgcagcatatgacagactttgccatccagtttaacaagaat
agcttcggtgtcatcccaagcactcccttggccatacatactccactgatgccaaaccag
agcattgacgtctctctgccgctcaacaccttgggcccagtcatgaagatggagcccctg
aataacctgcaggtggctgttaaaaacaatattgatgtcttctacttcagctgcctcatc
ccactcaatgtgctttttgtagaagatggcaaaatggagcgccaggtcttccttgcaacg
tggaaggatattcccaatgaaaatgaactccagtttcagattaaggaatgtcatttaaat
gctgacacagtttccagcaagttgcaaaacaacaatgtttacactattgccaagaggaac
gtggaagggcaggacatgctgtaccagtccctgaagctcactaatggcatttggattttg
gcagagctgcggatccagccaggaaaccccaattatacgctgtcgctgaagtgtagagcc
cctgaagtctctcagtacatctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system