KEGG   Mus musculus (mouse): 71770Help
Entry
71770             CDS       T01002                                 

Gene name
Ap2b1, 1300012O03Rik, AI788979
Definition
adaptor-related protein complex 2, beta 1 subunit
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mmu04144]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:mmu04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:mmu04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mmu05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B5
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTTTNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataagaagggagaaatttttgaattaaaagct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggacgtgagctctctcttcccagatgtggtgaactgcatgcagact
gacaacctggaactaaagaagctcgtgtacctctatctgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggattgtgaagatcccaatcct
ttgattcgagccttggcagttagaaccatgggatgcatccgggtggacaagattacagag
tatctctgtgaacccctccgcaagtgcttgaaggatgaagacccctatgttcggaaaacg
gcagcagtatgcgtggcaaaactccatgatatcaatgcccagatggtggaagatcaggga
tttctggattctctgcgggatctcatagcagattcaaacccaatggtggtggctaatgct
gtagcagcattgtctgagatcagtgagtctcacccaaacagcaacttacttgatctgaac
cctcagaatatcaataagctgctcacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgaccgggaagctcagagcatc
tgtgagcgagtaacgcctcggctctcccacgccaactctgcagtggtgctttcagccgta
aaagtcctaatgaagtttctagaattgttgcccaaggactctgactactacaatatgctg
ctaaagaagttagcacctccacttgtcacgttgctgtctggggagccagaagtacagtac
gtcgccctgaggaacatcaacctaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaggtcttctttgtgaagtacaatgatcctatctatgttaaactagagaagttagac
atcatgattcgtcttgcatcccaagccaacattgctcaggttctggcggagctgaaggaa
tatgccactgaagttgatgtggactttgttcgcaaagctgtgagggccattggacggtgt
gccatcaaagtggagcaatcagcagaacgctgtgtaagcacactgcttgatctaatccag
accaaagtaaattatgtggtccaagaggcaattgttgtcatcagggacatcttccgaaaa
taccccaacaagtatgaaagtattattgccaccctctgtgaaaacttggactccctggat
gaacccgatgcccgagcagctatgatttggattgtaggagaatatgctgaaagaatcgat
aacgcagatgaattactagagagtttcctggaaggttttcatgacgaaagcacccaggtg
cagctcacactgctcaccgccatagtgaagctgtttctcaagaagccatcagaaacacag
gagctggtccaacaggtcttgagcttagccacacaggactccgataaccctgaccttcga
gatcggggttatatatattggcgccttctttcaactgaccctgtgacagccaaagaagtg
gtgttgtctgagaagccattgatctctgaggagacagacctcattgagcctaccctcctg
gatgagctcatctgccacattggttctttggcctctgtgtaccacaaacctccaaatgct
tttgtggaagggagtcatgggattcatcgcaaacacttgccaattcatcatgggagcact
gatgcaggtgatagccccgttggcaccaccactacaaccaacctggagcagcctcaggtc
attccctctcaaggtgaccttctgggggatcttttgaatcttgacctgggtcccccagtg
aatgtcccgcaagtgtcctccatgcagatgggagcggtggatcttttaggaggaggactg
gatagcctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtaggacag
tccttcatcccgtcatcagtgcctgcgaccttcgctccttcacctactcctgctgtggtc
agcagtggtctgaatgacctgtttgagctttccactgggataggcatggcacctggcgga
tatgtggctcctaaggcggtctggctacctgcagtaaaggctaaaggcttggagatttcg
gggacgtttactcaccgccaagggcatatctatatggaaatgaacttcaccaacaaagct
ctgcagcatatgacagactttgccatccagtttaacaagaatagcttcggtgtcatccca
agcactcccttggccatacatactccactgatgccaaaccagagcattgacgtctctctg
ccgctcaacaccttgggcccagtcatgaagatggagcccctgaataacctgcaggtggct
gttaaaaacaatattgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggagcgccaggtcttccttgcaacgtggaaggatattcccaat
gaaaatgaactccagtttcagattaaggaatgtcatttaaatgctgacacagtttccagc
aagttgcaaaacaacaatgtttacactattgccaagaggaacgtggaagggcaggacatg
ctgtaccagtccctgaagctcactaatggcatttggattttggcagagctgcggatccag
ccaggaaaccccaattatacgctgtcgctgaagtgtagagcccctgaagtctctcagtac
atctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system