KEGG   Mus musculus (mouse): 71853Help
Entry
71853             CDS       T01002                                 

Gene name
Pdia6, 1700015E05Rik, AL023058, C77895, CaBP5, P5, Txndc7
Definition
protein disulfide isomerase associated 6 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    71853 (Pdia6)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     71853 (Pdia6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12 A1.1; 12
AA seq 445 aa AA seqDB search
MRVIGMARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWC
GHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQ
GGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVL
DSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIK
GFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQ
LCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFG
YPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPTITPREPWDGK
DGELPVEDDIDLSDVELDDLEKDEL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgatcggcatggctcgcctggtgctcggtctggtgagctgcaccttctttcta
gcagtcagcggtctgtattcttctagtgatgatgtcatcgagttgacgccatcaaatttc
aacagagaagttattcagagtgacggcctgtggcttgtagaattttatgcaccatggtgt
ggtcactgccagaggttaacaccagaatggaagaaagcagcaacggctttgaaagatgtt
gttaaagtcggggccgtcaatgcagacaaacatcagtccctgggaggtcagtatggtgtc
cagggatttcctaccatcaagatatttggagctaacaaaaacaagccagaagattatcag
ggtggcagaacgggagaagccattgtagatgccgccctcagtgccttgcgccagctcgtc
aaggatcgccttggtgggcggagtggtgggtacagttctggaaagcagggcagaggtgat
agttcaagtaagaaagacgtggtagagctgacggatgacacctttgataagaatgtcctt
gacagtgaagacgtttggatggttgagttttatgctccgtggtgtggacactgcaaaaac
ctggagccagaatgggctgctgcggctacagaagtaaaggagcaaacaaagggaaaagtg
aaactggcagctgtggatgccaccatgaatcaggttctggccagccgatacgggattaaa
ggattccctacaatcaagatatttcagaaaggcgagtctcctgtggactatgatggtggt
cggacgagatctgacatagtgtcaagggccctcgatttgttctctgataatgcccctcct
ccagagctgcttgagataatcaacgaagacatagccaagaagacatgcgaggagcaccag
ctctgtgtcgtggccgtactgcctcacatcctggacactggagctgcaggcagaaactct
tacttggaagttcttctgaaactggctgacaagtacaagaagaagatgtgggggtggctg
tggacagaagctggagcccagtatgaactggagaacgcactagggattggagggttcggg
taccctgccatggcagccatcaatgcacgcaagatgaaatttgctcttctcaaggggtct
ttcagtgaacaaggcatcaatgagtttctcagggaactgtctttcgggcgtggctccaca
gcacccgtagggggtggttcctttcctaccatcactcccagggagccctgggatggcaag
gatggtgagctccctgtggaggacgacattgacctcagtgacgtggagctggatgacctg
gagaaggatgagttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system