KEGG   Mus musculus (mouse): 71853Help
Entry
71853             CDS       T01002                                 

Gene name
Pdia6, 1700015E05Rik, AL023058, C77895, CaBP5, P5, Txndc7
Definition
protein disulfide isomerase associated 6 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mmu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12 A1.1; 12
AA seq 445 aa AA seqDB search
MRVIGMARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWC
GHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQ
GGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVL
DSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIK
GFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQ
LCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFG
YPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPTITPREPWDGK
DGELPVEDDIDLSDVELDDLEKDEL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgatcggcatggctcgcctggtgctcggtctggtgagctgcaccttctttcta
gcagtcagcggtctgtattcttctagtgatgatgtcatcgagttgacgccatcaaatttc
aacagagaagttattcagagtgacggcctgtggcttgtagaattttatgcaccatggtgt
ggtcactgccagaggttaacaccagaatggaagaaagcagcaacggctttgaaagatgtt
gttaaagtcggggccgtcaatgcagacaaacatcagtccctgggaggtcagtatggtgtc
cagggatttcctaccatcaagatatttggagctaacaaaaacaagccagaagattatcag
ggtggcagaacgggagaagccattgtagatgccgccctcagtgccttgcgccagctcgtc
aaggatcgccttggtgggcggagtggtgggtacagttctggaaagcagggcagaggtgat
agttcaagtaagaaagacgtggtagagctgacggatgacacctttgataagaatgtcctt
gacagtgaagacgtttggatggttgagttttatgctccgtggtgtggacactgcaaaaac
ctggagccagaatgggctgctgcggctacagaagtaaaggagcaaacaaagggaaaagtg
aaactggcagctgtggatgccaccatgaatcaggttctggccagccgatacgggattaaa
ggattccctacaatcaagatatttcagaaaggcgagtctcctgtggactatgatggtggt
cggacgagatctgacatagtgtcaagggccctcgatttgttctctgataatgcccctcct
ccagagctgcttgagataatcaacgaagacatagccaagaagacatgcgaggagcaccag
ctctgtgtcgtggccgtactgcctcacatcctggacactggagctgcaggcagaaactct
tacttggaagttcttctgaaactggctgacaagtacaagaagaagatgtgggggtggctg
tggacagaagctggagcccagtatgaactggagaacgcactagggattggagggttcggg
taccctgccatggcagccatcaatgcacgcaagatgaaatttgctcttctcaaggggtct
ttcagtgaacaaggcatcaatgagtttctcagggaactgtctttcgggcgtggctccaca
gcacccgtagggggtggttcctttcctaccatcactcccagggagccctgggatggcaag
gatggtgagctccctgtggaggacgacattgacctcagtgacgtggagctggatgacctg
gagaaggatgagttgtga

DBGET integrated database retrieval system