KEGG   Mus musculus (mouse): 71872Help
Entry
71872             CDS       T01002                                 

Gene name
Aox4, 2310003G12Rik, Aoh2
Definition
(RefSeq) aldehyde oxidase 4
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00350  Tyrosine metabolism
mmu00380  Tryptophan metabolism
mmu00750  Vitamin B6 metabolism
mmu00760  Nicotinate and nicotinamide metabolism
mmu00830  Retinol metabolism
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    71872 (Aox4)
   00350 Tyrosine metabolism
    71872 (Aox4)
   00380 Tryptophan metabolism
    71872 (Aox4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    71872 (Aox4)
   00760 Nicotinate and nicotinamide metabolism
    71872 (Aox4)
   00830 Retinol metabolism
    71872 (Aox4)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    71872 (Aox4)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    71872 (Aox4)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     71872 (Aox4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Fer2_2 Ald_Xan_dh_C Fer2
Motif
Other DBs
NCBI-GeneID: 71872
NCBI-ProteinID: NP_076120
MGI: 1919122
Ensembl: ENSMUSG00000038242
Vega: OTTMUSG00000026036
UniProt: Q3TYQ9
Position
1 C1.3; 1 28.97 cM
AA seq 1336 aa AA seqDB search
MPSVSESDELIFFVNGKKVIEKNPDPEKNLLFYTRKVLNLTGTKYSCGTGGCGACTVMVS
RYNPKTRKIHHYPATACLVPICWLHGAAITTVEGVGSIKKRVHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPDQITEALGGNLCRCTGYRPIVESGKTFSQKSTVCQMKGSG
KCCMDPDEKCLESREKKMCTKLYNEDEFQPFDPSQEPIFPPELIRMAEDPNKRRLTFQGK
RTTWIIPVTLNDLLELKASYPEAPLVMGNTTVGPGIKFNDEFYPVFISPLGVPELNLMDT
TNNGVTIGAGYSLAQLKDTLDFLVSEQPKEKTKTFHALQKHLRTLAGPQIRNMATLGGHT
ASRPNFSDLNPILAAGNATINVVSREGKDRQLPLNGPFLEKLPEADLKPEEVILSIFIPY
TAQWQFVSGLRLAQRQENAFAIVNAGMSVEFEEGTNTIKDLKMFFGSVAPTVVSASQTCK
QLIGRQWDDQMLSDACQLVLQEIRIPPDAEGGMVEYRRTLIISLLFKFYLKVQRWLNEMD
PQKFPDIPGKFVSALDDFPIETPQGIQMFQCVDPKQPQKDPVGHPIMHQSGIKHATGEAI
FIDDMPPIDQELCLAVVTSTRAHAKITSLDVSEALACPGVVDVITAEDVPGENDHNGEIL
YAQSEVICVGQIICTVAADTYIHAKEAAKRVKIAYDDIEPTIITIEEALEHNSFLSPEKK
IEQGNVDYAFKHVDQIVEGEIHVEGQEHFYMETQTILAIPQTEDKEMVLHLGTQFPTHVQ
EFVSAALNVPRSRIACHMKRAGGAFGGKVTKPALLGAVCAVAANKTGRPIRFILERSDDM
LITAGRHPLLGKYKIGFMNNGEIRAADVEYYTNGGCTPDESELVIEFVVLKSENTYHIPN
FRCRGRACKTNLPSNTAFRGFGFPQATVVVEAYIAAVASKCNLLPEEVREINMYKKTSKT
AYKQTFNPEPLRRCWKECLEKSSFFARKKAAEEFNGNNYWKKRGLAVVPMKFSVAVPIAF
YNQAAALVHIFLDGSVLLTHGGCELGQGLHTKMIQVASRELNVPKSYVHFSETSTTTVPN
SAFTAGSMGADINGKAVQNACQILMDRLRPIIRKNPKGKWEEWIKMAFEESISLSATGYF
KGYQTNMDWKKEEGDPYPYYVYGAACSEVEVDCLTGAHKLLRTDIFVDAAFSINPALDIG
QVEGAFIQGMGFYTTEELKYSPKGVLYSRGPEDYKIPTITEIPEEFYVTLVHSRNPIAIY
SSKGLGEAGMFLGSSVLFAIYDAVTTARKERGLSDIFPLNSPATPEVIRMACTDQFTEMI
PRDDPSTFTPWSIHVS
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgtctccgagtctgacgagctgattttttttgtgaatggaaaaaaggtcata
gagaagaaccctgaccctgaaaagaatctactgttctacaccaggaaagttctcaatctc
acaggcactaagtacagctgtggaacaggaggctgtggggcctgcactgtgatggtgtcg
agatataatccaaagaccaggaagatccaccactacccagcaacagcatgcctggtgccc
atctgctggcttcatggagcagccattaccacagtggaaggtgtggggagcatcaaaaag
agggtgcacccagtgcaggaacgacttgccaagtgtcacggcacccagtgtggcttctgc
agccctgggatggtgatgtccatctacacactgctcaggaaccacccggagccgacacct
gatcagatcacggaggctcttggagggaatttgtgccgatgcactggatatcgaccaatt
gtagaaagcgggaaaacattctcccagaagtctactgtttgccaaatgaagggatctggg
aaatgctgcatggatccagatgagaagtgtttggagagcagagagaaaaagatgtgtact
aaactgtataatgaagatgagttccagccgtttgacccatcccaggaacctatatttcct
cctgaactgattagaatggcagaagatccaaacaagaggaggctgacattccaagggaag
aggaccacctggatcatccctgtgacactgaatgacctcctggaactgaaagccagctac
cccgaagccccactcgtcatggggaacaccacagtgggacccggtattaaatttaatgat
gaattctatccagtttttatatccccacttggggttccagaactaaatcttatggacacc
acaaacaatggggtaacaataggagcaggatacagcctggcacagcttaaagataccttg
gattttctggtatcagaacaaccaaaggagaagaccaaaacctttcacgccctccagaaa
catctgaggacacttgcagggccccagattaggaatatggctactttaggaggacacact
gcaagccgtcctaatttttctgacctcaaccctattttggcagctggaaatgctaccatc
aacgtggtatctagagaaggaaaagatcgtcagctccctttaaatggccctttcctggag
aagttgcctgaggctgacttgaaaccagaagaggttatcttgtccattttcattccttac
actgctcagtggcagtttgtgtcaggactccggttggcacagcgtcaggaaaatgccttt
gctattgtcaatgctggtatgagcgtggagtttgaggaaggtacaaacacgatcaaggat
cttaagatgttctttggaagtgttgcccccactgtggtctctgcaagtcaaacctgcaag
cagctcattgggaggcaatgggacgaccaaatgctgagtgacgcatgccagctggtcctg
caggagatccgcatcccaccagatgctgagggaggcatggtggagtaccgacgcaccctc
atcatcagcttgctcttcaaattctacctcaaagtgcagcgatggctgaatgaaatggat
cctcagaagtttcctgacatcccaggaaagtttgtgagtgccctagatgacttccccata
gaaacaccccaaggaatccagatgttccagtgtgtggatcccaaacaaccccagaaagat
ccagttgggcacccaatcatgcaccagtcgggtattaaacatgccacaggggaagctata
tttattgatgacatgcctcccattgaccaagaactctgccttgccgttgtcacgagtacc
agggcccatgcaaagatcacatcacttgatgtatcagaagccctggcgtgtccaggtgtg
gttgacgtgatcacagctgaggatgtcccgggagaaaatgatcacaatggagagattctt
tatgcacagagtgaggtcatttgcgtgggtcagatcatctgcaccgtggctgctgatacc
tacatccatgcaaaagaagcagctaaacgagtgaagattgcttatgatgacatagagcca
accattatcaccatagaggaagccctagaacacaattctttcctttctcctgagaaaaaa
attgaacaaggaaatgtagactatgccttcaaacatgtggatcaaatcgttgaaggtgag
atccacgtggaagggcaggaacacttttacatggaaacgcaaaccatcctggctatccca
caaactgaagacaaagaaatggtgttacacttggggacacagtttccaacccacgtgcag
gaatttgtgtctgcagcattaaatgtcccaaggagcaggatcgcctgccacatgaaaaga
gctggaggagcatttgggggcaaagtgaccaagcctgctctactgggagctgtctgtgct
gtggctgccaacaagactggccgcccaatccgcttcatcctagaacgaagtgatgacatg
ctgataacagctggccgccacccactcctgggaaaatacaaaattgggttcatgaataat
ggagagatcagagctgctgacgttgaatattacactaatggaggatgcacccccgacgaa
tctgagctggtgatagaatttgtcgtgctgaaatctgaaaatacatatcatattccgaat
ttccggtgccggggcagggcttgcaaaacaaacttaccatctaacacggctttccgagga
tttggcttccctcaggctacggtggtcgtcgaagcatacatcgctgcggtagcatctaaa
tgtaacttactccctgaagaggttagagaaataaacatgtataagaaaactagcaagaca
gcctataagcagacgtttaatccagagcccttgcggagatgctggaaggagtgtctggag
aagtcgtcattctttgctaggaagaaggctgcagaggaatttaacggaaacaactattgg
aagaagagggggcttgctgtcgtccccatgaagttcagcgttgcggtccccatagccttc
tacaatcaggctgctgctctggtccacatcttcttagacggctctgtcctgctgacccac
ggtggctgcgagctgggacaaggcctacacactaagatgattcaggtagccagtagagaa
ctcaacgtccccaagtcgtacgtgcacttttctgaaaccagcactaccacagtgcccaac
tccgccttcactgcgggttccatgggagcagatatcaatgggaaggctgtacagaatgcc
tgccagattcttatggaccgtcttcggcccatcatcaggaaaaaccctaaaggaaaatgg
gaggaatggattaaaatggcctttgaagaatccatcagcctctcagccactggatatttc
aaaggctaccagacaaacatggactggaagaaggaggaaggtgatccctacccatactat
gtctatggcgcagcctgctctgaggttgaagtggactgtctgactggggctcacaagctc
ctgaggaccgacatcttcgtggatgctgccttcagcattaaccctgccctggatatcggg
caggttgagggagcctttatccaaggcatgggattctacaccacagaggagttgaaatac
tccccaaaaggtgtgctctattctcggggcccagaagactacaaaatccccaccatcact
gagataccagaggagttctatgtcactctggtgcattctcgaaatcccatagccatctac
tcatccaagggattgggtgaggctgggatgttcctggggtcctcagttttatttgccata
tatgatgccgtgaccactgcccgcaaggagagagggctgagcgacatcttccccttgaat
agcccagcaacacctgaagtgattcgcatggcttgtacggatcagtttactgagatgatt
cccagagatgacccttcaacattcacaccttggtccatccacgtgtcttaa

DBGET integrated database retrieval system