KEGG   Mus musculus (mouse): 71911Help
Entry
71911             CDS       T01002                                 

Gene name
Bdh1, 2310032J20Rik, AI327223, Bdh
Definition
3-hydroxybutyrate dehydrogenase, type 1 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mmu  Mus musculus (mouse)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mmu00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mmu00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 B2; 16
AA seq 343 aa AA seqDB search
MLAARLSRPLSQLPGKALSVRDRENGTRHTLLFYPASFSPDTRRTYASQADAASGKAILI
TGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGDAGVKELDSLKSDRLRTIQLNVCNSEEV
EKAVETIRSGLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSFL
PLLRRAKGRVVNISSMLGRMANPARSPYCITKFGIEAFSDCLRYEMHPLGVKVSVVEPGN
FIAATSLYSPERIQAIAKKMWDDLPEVVRKDYGRKYFDEKIAKMETYCNSGSTDTSSVIN
AVTHALTAATPYTRYHPMDYYWWLRMQIMTHFPGAISDKIYIH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctagctgcccgtctctccagacccctgtcacagctcccaggaaaagccctaagtgtc
cgtgacagagaaaatgggacaagacacacactgttgttttatccagcatccttcagccct
gacacccgtcggacctacgccagtcaggcagatgcggctagtggcaaagctatcctgatc
acaggctgtgactctggatttgggttctcactggccaagcatctgcactcaaaaggcttc
cttgtatttgctggctgtttgatgaaggacaaaggtgatgctggggtcaaggaactggac
agcttgaagagtgaccgactgagaaccatccagctcaatgtctgcaacagtgaagaggtg
gagaaggcggtggagacgatccgctccggcctgaaagatcctgagaagggaatgtggggc
ctggttaacaacgcaggcatctcaacgtttggggaggtggagttcaccagcatggagaca
tataaggaggtggctgaagtgaacctctggggaaccgtgcgcaccacaaaatccttcctt
ccccttctccgaagagccaaaggtcgcgtcgttaacatcagcagcatgctgggccgcatg
gccaaccccgcccgctcgccatactgcatcaccaagtttgggatcgaggctttctcggac
tgcctgcgctatgagatgcaccctctgggtgtcaaggtcagtgtggtggaacctggcaac
ttcatagcggccaccagtctctacagccccgagcgcatccaggccatcgccaagaagatg
tgggatgacctgcctgaggtcgtccgcaaggactatggcaggaagtacttcgatgaaaag
attgccaagatggaaacctactgcaacagcggttccacagatacttcctctgtcatcaac
gctgtcacacacgccttgaccgccgccaccccgtatacccgctaccatcccatggactac
tactggtggcttcggatgcagatcatgacccattttcctggagccatctctgacaagatc
tacatacactga

DBGET integrated database retrieval system