KEGG   Mus musculus (mouse): 71954Help
Entry
71954             CDS       T01002                                 

Gene name
Suds3, 2400003N08Rik, 2410008L21Rik, AU067672, mSds3
Definition
(RefSeq) suppressor of defective silencing 3 homolog (S. cerevisiae)
  KO
K19201  
Sin3 histone deacetylase corepressor complex component SDS3
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     71954 (Suds3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5; 5 F
AA seq 328 aa AA seqDB search
MSAAGLLAPAPAPAAAPAAPEYYPEDEEELESAEDDERSCRGRESDEDTEDASETDLAKH
DEEDYVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYRERIRNAELFLQLE
TEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPI
MTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEH
LPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVR
KTSDSTKMRIYVGQLQRGLFVIRRRSAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcggggctgctggctccggcgccggctccggctgcagcgccggccgccccg
gagtactacccggaggacgaggaggagttggagagcgccgaggacgacgagcgcagctgc
cggggccgagagtccgacgaagacaccgaggatgccagcgagactgacctggcgaagcac
gatgaggaagactacgtggagatgaaggaacagatgtatcaggacaaactggcatctttg
aagaggcagctgcaacagcttcaggaaggtacgctccaggaatatcagaaacggatgaag
aaactggaccagcagtaccgagagcggatccggaatgcagagctcttcctccagctggaa
acggaacaggtggagaggaattacattaaagagaagaaggcggccgtgaaggagtttgaa
gacaagaaggtggagctgaaggagaacctgattgccgagctggaggagaagaagaagatg
atcgagaacgagaaactcaccatggagctgactggagattctatggaagtgaaacccatc
atgaccagaaaattgcggaggcgaccaaacgatcctgtccccattccagacaagaggaga
aaaccggctcctgctcagctgaactacttgctaacagacgagcagatcatggaggacctg
aggacgctgaacaagcttaagtcacccaagagaccagcttccccatcctctcctgaacac
ttgcctgccacacctgcagagtctccagcccagaggtttgaggctcggatagaagatggc
aaactgtactatgataagagatggtaccacaagagccaggccatctacctggaatctaag
gacaaccagaagctgagctgtgtgatcagctcagtgggagccaacgagatctgggtgagg
aagaccagcgacagcaccaagatgcggatctacgtgggccagctgcagcgtgggctcttc
gtgatccgccggcggtcagcggcttga

DBGET integrated database retrieval system