KEGG   Mus musculus (mouse): 71994Help
Entry
71994             CDS       T01002                                 

Gene name
Cnn3, 1600014M03Rik, C85854, Calpo3
Definition
(RefSeq) calponin 3, acidic
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 G1
AA seq 330 aa AA seqDB search
MTHFNKGPSYGLSAEVKNKIASKYDQQAEEDLRNWIEEVTGLGIGTNFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYPDDYPREYQYGDDQGIDY
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacccacttcaacaagggcccttcctacgggctctccgccgaagttaagaacaagatt
gcatccaagtatgaccagcaggccgaggaagatctgcgcaactggatagaagaggtgaca
ggcctaggcattggcaccaacttccagctggggctgaaggacggcatcatattgtgcgaa
ctcataaacaagctacagccaggctctgtgaagaaagtcaacgaatcctcactaaattgg
ccccagttggagaatatcggcaacttcattaaagctatccaggcttacggtatgaagccc
catgatatatttgaagcaaacgacctctttgagaatggcaacatgacccaggttcagacg
acgctggtggctctagcaggtctggcgaaaacaaaaggattccatacaaccattgacatt
ggcgttaagtatgcagaaaaacaaacaagacgttttgatgaaggcaaattaaaggctggc
cagagtgtaattggtttacagatgggtaccaacaaatgtgccagccaggcgggcatgaca
gcctatgggactcggaggcatctttatgatcccaagatgcagacggacaaaccctttgac
cagaccacgattagcctgcagatgggcaccaacaaaggggccagccaggctgggatgtta
gcaccgggcaccagaagagacatctatgaccagaagctgacattacagccagtggacaac
tcgaccatttctctacagatgggcaccaacaaagttgcttcccagaaaggaatgagcgtg
tatgggcttgggcggcaagtatatgaccccaagtactgtgccgcacccacagaacctgtc
attcacaacggaagccagggcacgggcaccaatgggtcggaaatcagtgatagcgattat
caggcagaataccccgatgaatatcatggcgagtacccagacgactaccctcgggagtac
cagtatggcgacgaccagggcattgattattag

DBGET integrated database retrieval system