KEGG   Mus musculus (mouse): 72082Help
Entry
72082             CDS       T01002                                 

Gene name
Cyp2c55, 2010318C06Rik
Definition
cytochrome P450, family 2, subfamily c, polypeptide 55 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    72082 (Cyp2c55)
   00590 Arachidonic acid metabolism
    72082 (Cyp2c55)
   00591 Linoleic acid metabolism
    72082 (Cyp2c55)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    72082 (Cyp2c55)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    72082 (Cyp2c55)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    72082 (Cyp2c55)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    72082 (Cyp2c55)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     72082 (Cyp2c55)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   72082 (Cyp2c55)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 C3; 19
AA seq 490 aa AA seqDB search
MDPVLVLVLTLSCLLLLSLWRQNSGRGKLPPGPTPFPIIGNILQIDIKNISKSFNYFSKV
YGPVFTLYFGSKPTVVVHGYEAVKEALDDLGEEFSGRGSFQIFERINNDLGVIFSNGTKW
KELRRFSIMTLRSFGMGKRSIEDRIQEEASCLVEELRKANGSLCDPTFILSCAPSNVICS
VIFHNRFDYKDEKFLNLMERLNENFKILNSPWMQVYNALPTLINYLPGSHNKVIKNFTEI
KSYILGRVKEHQETLDMDNPRDFIDCFLIKMEQEKHNPHSEFTIESLMATVTDIFVAGTE
TTNITLRYGLLLLLKHTEVTAKVQAEIDHVIGRHRSPCMQDRTRMPYTDAMVHEIQRYID
LIPNNVPHAATCNVRFRSYFIPKGTELVTSLTSVLHDDKEFPNPEVFDPGHFLDENGNFK
KSDYFMPFSIGKRMCVGEALARTELFLILTTILQNFNLKSLVDTKDIDTTPVANTFGRVP
PSYQLYFIPR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccagtcctggtcctggtgctcactctctcctgtctgcttctcctctccctctgg
agacaaaactctgggagagggaagctccctcctggccccacccctttcccaattattgga
aacatccttcagatagatataaagaacatcagcaaatccttcaactatttctcaaaagtc
tatggccccgtgttcactctgtactttggttcaaagcctactgtggtggtacatggatat
gaagcagtaaaggaagctctggatgaccttggagaggagttttctgggaggggtagtttt
caaatttttgaaagaataaataatgatctgggggtgattttcagcaatggaacaaaatgg
aaggagcttcggcgcttctcaatcatgaccttgaggagttttgggatggggaagaggagc
atcgaggatcgcattcaagaggaagcatcctgtcttgtggaagagctaagaaaagcaaat
ggttcactctgtgatcccacattcatcctgagctgtgctccctccaatgtgatctgttca
gttattttccacaatcgttttgattataaagatgagaagtttcttaacttgatggagaga
ctcaatgaaaactttaaaatcttgaactccccatggatgcaggtctacaatgctctgcct
accctcatcaattatctcccagggagtcataacaaagtaattaaaaattttactgaaata
aaaagttacattttggggcgagtgaaagaacaccaggaaacactggacatggacaatcct
cgggacttcattgactgcttcctgatcaaaatggaacaggaaaaacacaatccccattcg
gagtttactattgaaagcttgatggccactgtaaccgacatatttgtagctggaacagaa
accacaaacattactctaagatatggactcttgctcctactgaaacacacagaggtcaca
gctaaagtccaggcagagatcgatcacgtgattggcagacacaggagcccctgcatgcag
gacagaacccgcatgccctacacagatgccatggtacatgagattcagagatacattgac
ctcatccccaacaatgtgccccatgcagctacctgtaatgttagattcagaagttacttc
atccccaagggcacagagttagtaacatcactgacttctgtgctgcatgatgacaaagaa
tttcccaacccagaagtatttgaccctggccattttctggatgagaatgggaactttaag
aagagtgactactttatgcctttctcaataggaaagcgaatgtgcgtgggagaggccctg
gctcgcacggagctgtttttgattctgaccaccattttacagaattttaacctgaaatct
ttggttgatacaaaggacattgacactactccagtggccaatacttttggccgtgtacca
ccttcataccagctgtacttcattcctcgttaa

DBGET integrated database retrieval system