KEGG   Mus musculus (mouse): 72303Help
Entry
72303             CDS       T01002                                 

Gene name
Cyp2c65, 2210009K14Rik
Definition
cytochrome P450, family 2, subfamily c, polypeptide 65 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mmu00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mmu00830]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mmu04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mmu04750]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mmu05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 C3; 19
AA seq 490 aa AA seqDB search
MVLGVFLGLLLTCLLLLSLWRQNSQRRNLPPGPTPLPIIGNILQLDLKDISKSLRNFSKV
YGPVFTLYLGRNPAVVLHGYEAVKEAFTDHGEEFAGRGVFPVFDKFKKNCGVVFSSGRTW
KEMRRFSLMTLRNFGMGRRSIEDRIQEEARCLVDELRKTKGEPCDPTFILGCAPCNVICS
IVFQNRFDYKDQEFLTFLDILNENVEILSSPWIQICNNFPAVIDYLPGRHRKLHKNFAFA
EHYFLSKVKQHQESLDINNPRDFIDCFLIKMEQEKHNPKTEFTCENLVFTASDLFAAGTE
TTSTTLRYSLLLLLKYPEVTAKVQEEIDCVIGRHRSPCMQDRHSMPYTDAVLHEIQRYID
LLPTSLPHAVTRDVKFREYLIPKGTTVIASLTSVLYDDKEFPNPEKFDPSHFLDERGKFK
KSDYFFPFSTGKRICVGEGLARAELFLFLTTILQNFNLKSPVDLKDLDTTPVANGFASVP
PKFQICFIPI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggttctaggtgtgtttctggggcttcttctcacatgtctgcttcttctttcactatgg
aggcagaattctcagagaagaaaccttcctcctggccccacacctctccccatcattgga
aatattcttcagctagatcttaaggacatcagcaaatctctgaggaatttttcaaaagtc
tatggccctgtgttcactctgtacttgggcaggaatcctgctgtggtgttacatggatat
gaagctgtgaaagaagcctttactgatcatggggaggagtttgctggaagaggagttttt
ccagtgtttgataagtttaagaaaaactgcggggttgttttcagcagtgggaggacctgg
aaagagatgagacgcttctcactcatgactctgcgaaactttgggatggggaggaggagc
attgaggaccgaattcaagaggaggctcgctgtcttgtggatgaattgaggaaaaccaaa
ggtgaaccctgtgatcccaccttcatcctcggctgtgctccttgcaatgtcatctgctcc
attgttttccagaatcgttttgattataaagatcaggaattccttaccttcttagacatc
ttaaatgaaaatgtggagattctgagttccccttggattcagatttgcaataattttcct
gctgtcattgattatctaccaggaagacacagaaaattacataaaaattttgcctttgca
gaacattactttttgtcaaaagtaaaacagcatcaagagtcactggatattaacaatcct
cgggactttattgattgtttcctgatcaaaatggaacaggaaaagcacaacccaaagacg
gagtttacttgtgagaacttggtcttcacagcatctgatctgtttgctgctgggacagag
acaacaagcacaaccctgaggtactctctgctgctcctgctcaagtatccagaagtcaca
gccaaagtccaggaagagatcgactgtgtgattggcagacacaggagcccctgcatgcag
gacaggcatagcatgccctacactgatgctgtgttgcatgagatccagagatacattgat
ctccttcccaccagccttccccatgccgtgacccgtgacgtgaaattcagagagtatctc
attcccaagggcaccactgtcatagcatcactgacttctgtgctatatgatgataaagaa
ttccccaacccagagaagtttgaccccagtcactttctggatgagcgtggcaagtttaag
aaaagtgactacttttttcctttctcaacaggaaaacggatttgtgtgggagagggtctg
gctcgagcagaattatttttattcctgaccaccattttacagaactttaacttgaaatct
ccagttgatctaaaagaccttgatactactccagttgccaatggatttgcttctgtgcca
cccaagttccagatatgcttcattcccatctaa

DBGET integrated database retrieval system