KEGG   Mus musculus (mouse): 72344Help
Entry
72344             CDS       T01002                                 

Gene name
Usp36, 2700002L06Rik, mKIAA1453
Definition
ubiquitin specific peptidase 36 (EC:3.4.19.12)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     72344 (Usp36)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   72344 (Usp36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E2; 11
AA seq 1098 aa AA seqDB search
MPIVDKLKEALKPGRKDSAEDGDLGRLLAASAKKVLLQRIEFEPASKSFSYQLESLKSKY
VLLSARAEGASRHRSGDELQARKPGTERVSGSGGDGVPAPQKVLFPVERLSLRWERVFRV
GAGLHNLGNTCFLNSTIQCLTYTPPLANYLLSKEHARSCHQGGFCMLCLMQNHMVQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLDRQTQATTL
VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDIALEIRQAANIVRALELFVKSDVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQSSG
DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFY
LRIPGSKKSPEGPVSRVGATLPSRPKVVPEHSKKSPGNGVVPSPLMAKRQDSVMMRKLPA
PEEVGVPVSRNGSLPGLKLQNGCAPAKTPAGSPSPRLTPTPTHMPTILDEPGKKVKKSAP
LQSLTTSPTTSQGSPGTGESRSQRPGSWASRDTIFSTSPKLLARAITNGHRLKGEGSGVD
LEKGDSSSSSPEHSASSDPAKAPQTAESRAAHACDSQGTNCPTAGHPKALLNGVDAKMVK
LKSPALSSTTTEPTSLMSPPPAKKLALSAKKASTLRRATGNDIGSPSPSAFCDLTSPMKA
THPVVASTGPVSKTRTAAPAPRPSTHPHSASLSSSSAKPLGTSEPQSCRPSAWTPLPQVN
GHFTSHLHQLPEASEALHSPSKKRKKTPNGDPQRLGIDTLLPQCLRGAPAAARRKRKKRC
SEGEGATAPKQEGQFQDQSWSSGSQKEEGTQPQVNGHQVSHILDSYHVSSRKRRKRKRSE
GLSQEATPSQDLIQHSCSPVDHSEPEARTELQKKKKKKRRKRKPEPQQDEESKHPGDQRS
PRPSVTPVPALSVNGHLPSDCLGLGQAPLVTWNRDQEPDVVQALLQDSSDKAYGKKVLTW
DGEPSAISQDAIKDSRLARTQTVVDDWDEEFDRGKEKKIKKFKREKKRNFNAFQKLQSRR
NFWSVTHPAKVASLSYRR
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagtcgataagctgaaggaggctctcaagcctggccgcaaggactcggccgag
gatggggacctgggcaggctgctggcagcctctgccaagaaggtgcttctgcagaggatt
gagtttgagccggccagcaagagcttctcctaccagctggagtccttgaagagcaaatac
gtactgttgagcgccagggctgagggagccagtcgccacaggagcggagatgaactccag
gccaggaaaccaggcaccgagcgtgtgtctggaagtggaggcgacggagtccctgccccg
cagaaagtgctcttccctgtggagcgtctgtccctgaggtgggaacgtgttttccgagtt
ggcgcagggctgcacaacctgggtaacacctgcttcctcaactccaccatccagtgcttg
acctacacaccacctctggccaactacttgctctccaaggagcacgcacggagctgtcac
caagggggcttctgcatgctgtgtctcatgcaaaaccacatggtccaggcctttgccaac
agcggcaatgctatcaagcccgtctccttcatcagagacctgaaaaagattgcccggcac
ttccggttcgggaaccaagaggatgcacacgaattcctgcggtacaccattgatgcgatg
cagaaggcctgcttgaatggctacgctaagttggatcggcagacacaggctactaccctg
gtgcatcagatctttggaggctatctcaggtcccgagtgaagtgctctgtgtgcaagagt
gtctcagacacatacgatccctacttggacatagcactggagatccggcaagctgcaaat
attgtgcgcgctctggaactttttgtgaagtcagatgtcctgagtggagagaacgcctat
atgtgtgctaagtgtaagaagaaggttccagccagcaagcgcttcaccatccatagaaca
tccaatgtcctgactctgtccctcaagcgcttcgccaactttagtggggggaagatcacc
aaggatgttggctatccagagttcctgaacatccgtccatacatgtcgcagagcagcggt
gatcctgtcatgtatgggctctatgctgtcctggtgcactcaggctacagctgtcacgct
gggcactactactgctatgtgaaggccagcaatggacagtggtaccagatgaacgactcc
ttggtccattccagcaatgtcaaggtggttctgaaccagcaggcctacgtgctcttctat
ctgcggattccaggctctaagaaaagtcctgagggccctgtctccagagtgggcgccact
ctccctagccgtcccaaagttgttccagagcactccaagaagagccctggcaatggggtt
gttccctccccgctgatggcaaagcgacaagactctgtaatgatgagaaagctcccagcc
cctgaggaggttggcgtacctgtgtccagaaatggctcccttcctggcctgaagttacag
aacggatgtgctcctgccaagacacctgccgggtccccgtccccaagactcacgcccacg
cccactcatatgcccaccattctggatgagcccggaaagaaggtgaagaagtcagcccca
ctgcagtctctcaccacatctccaaccacttctcagggctctcctgggaccggcgagtcc
cggagccagcggcccggctcctgggcaagcagagacaccatcttctctacctccccgaag
ctcctggccagagccattactaacgggcacaggctgaagggcgaaggcagtggtgtggac
ctggagaagggggattcaagcagctccagccccgagcactctgccagcagtgaccctgcc
aaggccccgcagaccgcagagagcagagctgcgcatgcctgtgattctcagggaacaaac
tgtcccaccgctggccatcccaaagcgctgttgaatggagtagatgccaagatggtgaag
ttgaagtccccggccctgagcagcaccacaaccgagcccacaagcctcatgtctcctcca
ccagccaaaaaactggccctgtcagccaagaaggccagcaccctgcggagggcgaccggc
aatgacatcggttcaccttccccctcagcattctgcgacctcacctcccccatgaaagcc
acccaccccgtcgttgcctccactgggcctgtcagtaagaccaggactgctgcacctgcc
ccccgaccgtccacccacccccactctgcatctctgtccagtagtagtgccaagccctta
gggacatcagagccacagagctgccgcccctctgcctggacacccctgcctcaggtcaat
ggacacttcacgtcccacttacaccaactgccagaggccagcgaggccctacacagcccc
tccaaaaagaggaaaaagacccctaatggagatccccagagactgggcatcgacacgctc
ctcccacagtgcctcaggggagcacctgcagcagcacgcaggaagagaaagaagaggtgc
tcggagggtgagggtgccacagctcccaagcaggaaggccaatttcaggaccagtcttgg
agttccgggagccagaaggaagagggtacgcagccccaggtaaatggccatcaagtgagt
cacattctggacagttaccatgtgagcagcaggaaaaggaggaagaggaaaagatcggaa
ggactcagccaggaagccaccccgtcgcaggacctaattcagcacagctgctcccctgta
gaccacagtgagcctgaggccaggacagagttgcagaagaagaagaagaagaaaagaagg
aaaagaaagcccgagccacagcaggatgaagagagcaagcacccaggagaccagaggagc
ccaaggcccagtgtcaccccagtccctgcgttgagtgtgaatggccatcttcctagtgac
tgcttggggctgggacaagcacctctcgttacctggaacagagatcaggaacccgatgtg
gtccaggcgttgcttcaggactcatctgataaggcttatgggaaaaaagttttgacctgg
gatggcgagccttcagccatcagtcaggacgccatcaaagacagcagactagcccggacc
cagaccgtggttgacgactgggatgaagagtttgatcgagggaaggaaaagaaaattaaa
aagttcaagagagaaaagaagagaaacttcaatgccttccagaagcttcagagtaggcgc
aacttttggtctgtgacgcatcctgctaaggtggccagcctcagctatcgccgctga

DBGET integrated database retrieval system