KEGG   Mus musculus (mouse): 72361Help
Entry
72361             CDS       T01002                                 

Gene name
Ces2g, 2210023G05Rik, Ces2l
Definition
carboxylesterase 2G (EC:3.1.1.1)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
mmu  Mus musculus (mouse)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    72361 (Ces2g)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     72361 (Ces2g)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     72361 (Ces2g)
    3.1.1.84  cocaine esterase
     72361 (Ces2g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 D3; 8
AA seq 560 aa AA seqDB search
MPRNQMHSWLDAVFFGLLLLLGHVQGHDSPETSPIRSTHSGQVQGRLIHVKDTKAGVHTF
LGIPFAKPPVGPLRFAPPEAPEPWSGVRDGTSQPAICPQNVTMNMEGLKELKLTLPPVSM
SEDCLYLNIYTPAHAQEGSNLPVMVWIHGGALTVGMASMYDGSVLAATEDVVVVAIQYRL
GVLGFFSTGDEHARGNWGFLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGISVSSHVV
SPMSKGLFHRAIMESGVALLPGTIFSFSEVVYQTVAKLSGCEAMDSEALVRCLRGKSEEE
ILAISKNFQMIPGVVDGEFLPKHPQELLASADFHPVPSIIGFNNDEYGWIVPKVIGSTQT
IKGITRENLQAVLKDTAPQMMLPPECSDLLMEEYMEDIEDPKTLQIQFTEMMEDFMFVIP
SLQVAYFQRSHAPVYFYEFQHQSSFLKDVRPPHVNADHGDEVPFVFGSFFWGMKLNLTEE
EKLLNRRMMKYWANFARHGNPNSESLPYWPVFDHDEQYLQLNIQPAVGQFQKARKLQFWT
KTLPRKIEELKRSQNVHKEL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgccacggaaccaaatgcatagctggctggatgctgtgttctttggactcctgcttctc
ctcggccatgtgcagggtcacgactcaccagagaccagccccatcagaagcacacactct
ggccaggtccaaggcaggctcattcacgtgaaggacactaaagctggtgtccacaccttc
ctgggaatcccctttgccaagcctcctgtaggaccactgcgctttgcacctcctgaggcc
cctgagccatggagtggtgtgagagatggaacctcacagccagccatttgtccacaaaat
gttacgatgaatatggagggcctgaaggagttgaaactgaccctgccacctgtctctatg
tccgaggactgcctgtatctcaacatctacacaccagcccacgcccaggagggctctaac
ctgcctgtgatggtgtggatccacggtggtgcactcactgtaggcatggcttccatgtat
gatggatccgtgctggcagccactgaggatgtggtggtggtcgctatccagtaccgcctg
ggtgtcttgggattcttcagcactggagatgaacatgccaggggaaactgggggttcctg
gaccaagtggctgccctacgctgggtccagcagaacatcgcccactttggtggcaaccct
gaccgggtcactatttttggcgagtcagcaggaggcataagcgtgtcttcgcatgttgtg
tcccccatgtccaaaggactctttcacagagccatcatggagagtggagtagctctgttg
cctggaaccatatttagcttctctgaggtggtttaccaaacggtggccaagctctctggt
tgtgaggccatggattcagaggccctggtgcgctgtctgagaggcaagagtgaagaggag
attctagctattagcaagaacttccagatgatccctggtgtggtggatggagagttccta
cccaagcatcctcaggagctgctggcctctgctgattttcaccctgtccccagcatcatt
ggtttcaacaatgatgagtatggttggatcgtccccaaagtcataggctctactcagaca
ataaagggaataaccagagagaacctgcaggctgtcctgaaggatacagcaccgcaaatg
atgctgcctcctgagtgtagtgatctgttgatggaagagtacatggaggacattgaggac
cccaagactcttcaaatacagttcaccgaaatgatggaagacttcatgtttgtgatccct
tctctccaagtagcatattttcagcgttcccatgcccctgtctacttctatgaattccaa
catcaatccagcttcctcaaggatgtcaggccaccccacgtgaacgctgaccatggagat
gaggttccttttgtttttggttccttcttctggggcatgaaacttaacctcactgaagag
gaaaagctgctaaacaggagaatgatgaagtactgggccaactttgcaagacatgggaac
cccaacagtgagagtctaccctactggcccgtgtttgaccatgatgaacagtatctacag
ctgaacatccagcctgctgtgggacaattccagaaggccagaaagctgcagttctggacc
aagactctgccccggaagattgaggagttaaagagatctcaaaacgtgcacaaagagcta
tag

DBGET integrated database retrieval system