KEGG   Mus musculus (mouse): 72475Help
Entry
72475             CDS       T01002                                 

Gene name
Ssbp3, 2610021L12Rik, 2610200M23Rik, 5730488C10Rik, AI854733, AW551939, LAST, SSDP1
Definition
(RefSeq) single-stranded DNA binding protein 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 C7
AA seq 388 aa AA seqDB search
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLH
SWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGF
FQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPL
LPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMG
PGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINP
VPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGT
PRDDGELGGNFLHSFQNDNYSPSMTMSV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccaaaggcaaaggctcggcggtgccctcggacgggcaggctcgggaaaagtta
gctttatacgtctacgaatatttactgcacgtaggagcacagaaatctgcacagaccttc
ttatcagagattcgatgggaaaaaaacatcacactgggtgaaccgcctgggttcctgcac
tcgtggtggtgtgtattttgggacctttactgtgcagctcctgaaaggagagacacttgt
gaacattcaagtgaagcaaaagcctttcatgattatagtgcagcagctgccccaagccct
gtgcttggcaacattccccccaatgatgggatgcccggaggccccatcccgccaggtttc
tttcagggtcctccggggtcacagccctcgccgcacgcacagcctccacctcacaatccc
agcagcatgatgggaccccacagtcagccttttatgtcaccgcgatatgcaggcggcccc
aggcccccgatcagaatgggaaaccagcctccaggaggagttcctgggacacagccactg
ctgcccaattccatggatcccacacgacaacaaggtcaccccaacatgggaggatcaatg
cagagaatgaaccctccccgaggcatggggcccatggggcctggcccacagaattacggc
agcggcatgagaccaccacccaactccctcggccccgccatgcctgggattaacatgggc
ccaggagctggcagaccctggcccaatcccaacagtgctaactcaatcccgtactcctca
tcatcacccggaacctatgtgggaccccctggtggtggtggccctccaggaacccccatc
atgcctagtcctgcagattcaacaaattccagtgacaacatctacacaatgattaatcct
gtgccgcctggaggcagccggtctaactttccaatgggtcctggctcagacggcccaatg
ggaggcatgggcggcatggagccccaccacatgaatggatccctaggatcaggtgacata
gatggacttccaaaaaattctcctaacaacataagtggcattagcaatcctccaggcacc
cctcgcgatgacggcgagctaggggggaacttcctccactccttccagaacgacaattat
tctccgagcatgacgatgagcgtgtga

DBGET integrated database retrieval system