KEGG   Mus musculus (mouse): 72482Help
Entry
72482             CDS       T01002                                 

Gene name
Acbd6, 0610010G04Rik, 2610100E10Rik
Definition
(RefSeq) acyl-Coenzyme A binding domain containing 6
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: ACBP Ank_5 Ank_4 Ank_2 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 72482
NCBI-ProteinID: NP_082526
MGI: 1919732
Ensembl: ENSMUSG00000033701
Vega: OTTMUSG00000034796
UniProt: Q9D061 Q14BV7
Position
1; 1 G3
AA seq 282 aa AA seqDB search
MATPFLPSGATTGDSGGELSSGDDSGDMESFQTPEAEGTRSLAELFEKAAAHVQGLVQVA
SREQLLYLYARFKQVKVGNCNTPKPNFFDFEGKQKWEAWKALGDSSPSQAMQEYIAAVKK
LDPGWNPQVSEKKGKEGSSGFGGPVVSSLYHEETIREEDKNIFDYCRENNIDHIAKAIKS
KAADVNMTDEEGRALLHWACDRGHKELVKVLLQYEAGINCQDNEGQTALHYAAACEFLDI
VELLLQSGADPTLRDQDGCLPEEVTGCKAVSLLLQRHRASKA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggccacaccgttcctaccctcgggggccaccacaggcgacagcggtggggaactgagc
tccggggacgactctggtgatatggaatccttccagacccccgaggccgaggggacccgg
agtttggccgagctgtttgagaaggctgccgcacacgtccaaggcctggttcaggtagcc
agccgggagcagctcctgtacctgtatgccaggttcaagcaggtcaaagttggaaattgc
aatactcctaaaccaaatttctttgattttgaaggaaagcaaaaatgggaggcatggaaa
gccctcggtgactcaagccctagccaagcaatgcaggaatatatcgcggcagttaaaaaa
ctagatccaggatggaatcctcaggtatcagagaagaagggaaaagaaggcagtagtggt
ttcggtggtccggttgttagttctctatatcatgaagaaacaatcagggaagaagacaaa
aacatatttgattactgcagggaaaacaacattgaccatatagccaaagccatcaaatcg
aaagctgcggatgtgaatatgacagatgaagagggcagagctctgctccactgggcatgt
gaccgaggacataaggaactggtgaaagtcttgctacagtatgaagctggcattaattgt
caggacaacgaaggtcagacagctcttcattatgccgctgcctgcgagtttttggacatc
gtggaactgctgctccagtctggcgctgaccccaccctccgagaccaagacggctgcttg
ccagaagaggtgacgggctgcaaagcggtctctctgctgctgcagcggcacagagctagc
aaggcttga

DBGET integrated database retrieval system