KEGG   Mus musculus (mouse): 72508Help
Entry
72508             CDS       T01002                                 

Gene name
Rps6kb1, 2610318I15Rik, 4732464A07Rik, 70kDa, AA959758, AI256796, AI314060, S6K1, p70/85s6k, p70s6k
Definition
(RefSeq) ribosomal protein S6 kinase, polypeptide 1 (EC:2.7.11.1)
  KO
K04688  
p70 ribosomal S6 kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
TGF-beta signaling pathway
Fc gamma R-mediated phagocytosis
Insulin signaling pathway
Insulin resistance
Proteoglycans in cancer
Acute myeloid leukemia
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    72508 (Rps6kb1)
   04350 TGF-beta signaling pathway
    72508 (Rps6kb1)
   04066 HIF-1 signaling pathway
    72508 (Rps6kb1)
   04151 PI3K-Akt signaling pathway
    72508 (Rps6kb1)
   04152 AMPK signaling pathway
    72508 (Rps6kb1)
   04150 mTOR signaling pathway
    72508 (Rps6kb1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    72508 (Rps6kb1)
  Endocrine system
   04910 Insulin signaling pathway
    72508 (Rps6kb1)
  Aging
   04211 Longevity regulating pathway - mammal
    72508 (Rps6kb1)
   04213 Longevity regulating pathway - multiple species
    72508 (Rps6kb1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    72508 (Rps6kb1)
   05205 Proteoglycans in cancer
    72508 (Rps6kb1)
   05221 Acute myeloid leukemia
    72508 (Rps6kb1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    72508 (Rps6kb1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     72508 (Rps6kb1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   72508 (Rps6kb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 C
AA seq 525 aa AA seqDB search
MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTVSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacctagcgcctgacttccgacacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaagatgcaggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaagatattt
gccatgaaggtgcttaaaaaggcaatgatagtgaggaatgctaaggacacggcccacacg
aaagcagagcggaacattctggaggaagtgaaacaccctttcattgtggacctgatttat
gcctttcagaccggaggaaagctctacctcatcctcgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatattcatggaagacacagcgtgcttttacttggct
gaaatctccatggctttggggcatttacatcaaaaagggatcatctacagagacctgaag
ccggagaacatcatgcttaatcaccaaggtcacgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacgcacacattttgtggaacaatagaatacatg
gcccctgaaatcttaatgagaagcggccacaaccgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaacttaatttgcctccctacctcacacaagaagct
cgagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggccct
ggggatgctggagaagtccaagctcatccttttttcagacacattaactgggaagaactt
ctggctcggaaggtggaacctccctttaagcctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagccctgatgactccactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcatttgaaccaaaaatccgatctcctagaagatttattggt
agtccacgaacacctgtcagcccagtcaaattctctcctggggatttctggggacgaggt
gcttcagccagcacggcaaatcctcagacccctgtggaatacccaatggaaacaagtggg
atagagcagatggatgtgacagtgagcggggaagcatcagcgccacttccaatccgacaa
cccaactccgggccgtacaaaaaacaagcttttcctatgatctccaaacggccagagcac
ctgcggatgaatctatga

DBGET integrated database retrieval system