KEGG   Mus musculus (mouse): 72599Help
Entry
72599             CDS       T01002                                 

Gene name
Pdia5, 2700053F16Rik, AU015525, Pdir
Definition
protein disulfide isomerase associated 5 (EC:5.3.4.1)
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     72599 (Pdia5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
16 B3; 16
AA seq 517 aa AA seqDB search
MARAWGLLLAIGVVLPTWLSSTKVSSLIERISDPKDLKKLLRTRNNVLVLYSESEVAAES
HLKLLSTVAQAVKGQGTVCWVDCGDAESRKLCKKMKVDLSPKDKKIELFHYQDGAFHMQY
DRAVTLKSIVAFLKDPKGPPLWEEDPGAKDVVHIDSEKDFRRLLKREEKPLLMMFYAPWC
SMCKRIMPHFQKAATQVRGHIVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFLFPY
ENYGSTAEDIVEWLKNPLPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHA
PWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATVNEALAGRFHISAFPTLKYFKNGE
QQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRDTLKKKKHTLVMFY
APWCPHCKKVIPHFTATADAFKEDRKIACAAVDCVKDKNQDLCQQEAVKAYPTFHYYHYG
KLVEKYESDRTELGFTSFIRTLREGDLKRLEKRREEL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggcgtgggggctgctactggcgattggggtggtcctgccgacatggctgtcc
tccacaaaggtctcttcgctcattgagagaatctccgaccctaaggacttgaagaaactt
ctcaggacccgcaataacgtgctggtgctttactcggaatccgaggtagcagctgaaagt
catcttaagctcctgtccaccgtggcccaggcagtgaaaggccaaggcaccgtctgctgg
gtggactgcggtgacgcagagagtagaaaattgtgcaagaagatgaaagttgacctcagc
ccaaaggacaaaaagattgaattattccattaccaggacggcgcctttcacatgcagtat
gaccgagctgtgacgttgaagtccatagtggcctttctgaaagaccctaaaggtccccca
ctgtgggaagaagatcctggagccaaagatgttgtgcacatcgacagtgagaaggacttc
agacgactcctgaagagagaagagaagccactgctcatgatgttctatgctccctggtgc
agcatgtgcaagagaatcatgccacatttccagaaggctgccacccaagtgcgaggccac
attgtcctggctgggatgaacgtctacccatcagagttcgagaacatcaaggaagagtac
aatgtccgcggctaccctaccatctgctatttcgagaaggggcggtttctgttcccgtat
gagaactatgggtccacggccgaggacatcgtggagtggttgaagaatccactgccacca
cagccccaggtccccgagactccctgggcagatgagggcggctccgtttatcacctgacc
gatgaagactttgaccagtttgtgaaggagcactcctctgtcctcgtcatgttccacgcc
ccatggtgtggacattgtaagaaaatgaagccagagtttgagagtgctgctgaagtcctc
cacggagatgctgagagctctggtgtacttgcagctgtcgatgccaccgtcaacgaggcc
ctggcaggaagatttcacatctcagcgtttcctaccctgaagtattttaagaatggcgag
cagcaagcggtgcctgcgctcagaacaaagaagaagtttattgagtggatgcagaaccct
gaggctcccccacctccagagcccacgtgggaagaacagcagacaagcgtgctacatctg
gtgggggataacttccgggataccctgaagaagaagaaacacaccttggtcatgttctat
gccccttggtgcccacactgtaagaaggtcatcccccacttcactgccacagccgatgcc
ttcaaagaggaccgcaagattgcctgtgctgctgtagactgtgtcaaggacaagaaccaa
gacctgtgtcagcaggaggccgtgaaggcctaccccaccttccactactaccactacggg
aagctcgtagaaaagtatgagagcgaccgcacggagttgggatttaccagtttcatccga
accctccgggagggagacctcaagagactagagaaaaggagggaagagctgtaa

DBGET integrated database retrieval system