KEGG   Mus musculus (mouse): 72607Help
Entry
72607             CDS       T01002                                 

Gene name
Usp13, 2700071E21Rik, AI848077, ISOT3, IsoT-3
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3) (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     72607 (Usp13)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   72607 (Usp13)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   72607 (Usp13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
3 A3; 3
AA seq 858 aa AA seqDB search
MQRRGALFSVPGGGGKMAAGDLGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEGGL
YVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHMREKVRGASGGALPKRRNSKIFLDLDM
DDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTW
ENEVPVSKYANNLVQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGN
GHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEGPVSDPHLAKHLAHFGIDMLHTQGTE
NGLRDNDIKPRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEFQR
AYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQQN
GISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQ
CCQTRKVRYTERVDYLMQLPVAMEAATNKDELITYELMRREAEANRRPLPELVRAKIPFS
ACLQAFAEPDNVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPRKFDVS
IDMPDLLDISHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQLA
EMGFPLEACRKAVYFTGNTGAEVAFNWIIVHMEEPDFAEPLAIPGYGGAGASVFGATGLD
NQPPEEIVAIITSMGFQRNQAVQALQATNHNLERALDWIFSHPEFEEDSDFVIEMENNAN
ANIVSEAKPEGPRVKDGSGMYELFAFISHMGTSTMSGHYVCHIKKEGRWVIYNDHKVCAS
ERPPKDLGYMYFYRRIPS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccggggcgccctgttcagcgtgccgggcggcggcgggaagatggctgcaggg
gacctgggcgagctgctggtgcctcatatgcccacgatccgcgtgcccaggtcgggggac
cgcgtctacaagaacgagtgcgccttctcctacgactccccgaactctgaaggtgggctc
tacgtatgcatgaatacctttttggcctttggaagggaacacgtagaaagacactttcga
aaaactggacagagcgtatacatgcacctgaagaggcacatgcgagagaaggtaagagga
gcctctggtggagctttacccaaaaggaggaattccaagatatttttagatctagatatg
gatgacgatttaaatagtgacgattacgaatatgaagacgaagccaaacttgttatattc
ccagaccactatgaaatagcccttcctaacattgaggagttaccagccctggtaacaatt
gcttgtgatgcagtgctcagctcaaagtccccttacaggaagcaggatccagacacatgg
gaaaacgaagtgccagtatcgaagtatgccaacaaccttgtgcaactggacaacggggtc
aggattcctcccagtggctggaagtgtgcccgatgtgacctgcgggagaacctctggttg
aatctgactgacggctctgttctgtgtgggaagtggttttttgacagctcagggggcaac
ggccacgcactggagcattacagggacatgggctatcctctggccgtgaagctgggcacc
atcacacctgatggggcagatgtttattcttttcaagaagaggggcctgtttcggatcct
catttggccaaacacttagcacattttgggatcgacatgctccacacgcaagggacagag
aacggtctccgggacaatgacatcaaaccgagagtcagcgagtgggaagtgatccaggag
tcaggaactaagctgaagccgatgtacggcccagggtacacgggcctgaagaacctgggc
aacagttgctacctcagttctgtcatgcaggccatcttcagcatcccagagttccagaga
gcgtatgtaggaaacctcccaaggatatttgactactcaccgttagatccaacgcaggac
ttcaacacacaaatgactaagttgggacatggcctcctctctggccagtactcgaagcct
ccagtgaaatctgagctcattgaacaggtgatgaaggaggagcacaagcctcagcagaat
gggatctctccacgcatgttcaaggcctttgtcagcaagagccacccggaattctcctcc
aacagacagcaggatgcccaggagtttttcttgcatttggtcaatctggtagagaggaat
cgcattggctcagaaaacccaagtgatgttttccggtttttggtggaggagcgaattcaa
tgctgtcagaccagaaaggttcgctacacggagagggtggactacctaatgcagttacct
gtggccatggaggcagcaaccaacaaagatgagctgatcacctatgaactcatgcggagg
gaagcagaagccaacagaagacccctacctgagctggtgcgagccaagatcccattcagt
gcctgccttcaggcctttgctgaaccagacaatgtggatgatttctggagcagcgctctg
caggccaagtctgcaggggtcaaaacttctcgctttgcctcattccctgaatacttggta
gtgcagataaagaagttcacttttggtcttgactgggttcccagaaaatttgatgtttct
attgatatgccagacctactagatatcagccatctcagagccaggggcttgcagccaggg
gaagaggagcttcctgacatcagcccccccatagtcattcctgatgactcaaaagaccgc
ttgatgaaccagttgatagacccctcagacattgatgagtcttcggtgatgcagctggct
gagatgggcttccctttggaagcctgcaggaaggctgtgtacttcacggggaacaccgga
gctgaggtggccttcaactggattatcgtgcacatggaggagcctgactttgctgaacca
ctggccatacctgggtatggaggggctggggcctctgtctttggtgctactggattggac
aaccaacctcctgaggaaatcgtagctattatcacctcgatgggattccagcgaaatcag
gcagtgcaggctctacaagcaacgaatcataacctggaaagagcactggactggatcttc
agccaccccgagtttgaagaggacagtgactttgtgatcgagatggagaacaatgcaaat
gccaacatcgtgtctgaggccaagccagagggacccagagtgaaggatgggtctggaatg
tacgagttgtttgctttcatcagtcacatgggaacatctacaatgagtggccattatgtt
tgccatatcaagaaagagggacgatgggtgatctacaatgaccacaaagtttgtgcctca
gaaaggccccccaaagacctgggctatatgtacttttaccgcaggataccaagctaa

DBGET integrated database retrieval system