KEGG   Mus musculus (mouse): 72828Help
Entry
72828             CDS       T01002                                 

Gene name
Ubash3b, 2810457I06Rik, BB125008, STS-1, TULA-2, p70
Definition
(RefSeq) ubiquitin associated and SH3 domain containing, B
  KO
K18993  
ubiquitin-associated and SH3 domain-containing protein [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     72828 (Ubash3b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Suppressors of T-cell receptor signaling
    72828 (Ubash3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9; 9 A5.1
AA seq 638 aa AA seqDB search
MAAREELYSKVTPRRDRLQRPGTVKHGSALDVLLSMGFPRARAQKALASTGGRSVQAACD
WLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQ
FFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAAD
FAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRDI
RFANHETLQVIYPYSPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPE
NYITKADECSTWIFHGSYSILNTVSSSSLAFGDGALERRQYEDQGLGETTPLTIICQPMQ
PLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGG
FRDYEKDAPITVFGCMQARLVGEALLESNTVIDHVYCSPSLRCVQTAHNILKGLQQDNHL
KIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPVSKLAISESYDTYIN
RSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFC
SCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgcgaggagctgtacagcaaagtcaccccgcgcagggaccgcctgcagcgc
ccgggcacagtcaagcatgggtcggcgctggacgtgctcctgtccatgggctttccccgc
gcccgcgcacaaaaagctctggcatccacgggaggaagaagcgttcaggcagcatgtgac
tggttgttctcccatgtgggtgaccccttcctggatgaccccctgcctcgggagtatgtc
ctctacctccgcccgacagggccattagcccagaagctctctgacttctggcagcagtcc
aagcagatctgcgggaagaacaaggcccacaacatcttcccccacatcactctctgccag
ttcttcatgtgcgaggacagcaaggtggatgctctgggggaagccctgcagactactgtc
agtcgatggaaatgtaagttctcagccccactgcccctggagctgtacacctcctccaac
ttcatcgggctcttcgtgaaggaagacagcgctgaagtcctcaagaagttcgcggctgac
tttgctgcagaggctgcatccaaaacagaagtgcacgtggagcctcataagaagcagctg
catgtgacgctggcctaccacttccaagccagccacctacccaccctagagaagcttgcc
cagaacattgacgtcaagctaggatgcgactgggtggccaccatattctctcgggatatc
cggtttgctaaccatgagacgttacaggtgatctatccctattcacctcagaatgatgac
gagctggagctggtcccaggggacttcatcttcatgtctcccatggaacagaccagcacc
agtgagggctggatttatggcacctcgctgaccactggctgctctgggctgcttcctgag
aactacatcaccaaggctgatgagtgtagcacctggatcttccatggttcctactccatc
ctaaataccgtatcatccagctcactcgcgtttggcgatggagcgttagagaggcggcag
tatgaagatcaaggacttggggagacaacacccctcactatcatctgccagcccatgcag
cccctgagagtcaacagccagcctggaccccagaagcgatgcctctttgtatgtcggcat
ggggagaggatggacgttgtatttgggaagtactggctgtcccaatgctttgatgccaaa
ggccgctacatacgcaccaacctgaacatgcctcacagtttacctcagaggagcggcggt
ttccgggattacgagaaagatgctccaatcactgtgtttgggtgtatgcaagcaagacta
gtgggtgaagccttgttagaaagtaatactgttattgatcacgtgtattgctcaccatcc
ctccgctgcgttcagactgcacataatattttgaaaggtttacaacaagacaatcacttg
aagattcgagtggagccgggcttatttgaatggacaaagtgggttgctgggagcacatta
ccggcatggatacctccatcagagttagctgcagccaacctgagtgttgatacaacctac
agacctcacattccagtcagcaaattggcgatttcggaatcctatgacacctacatcaat
aggagtttccaggtgacgaaagagataataagtgaatgcaaaagtaaaggaaataacatt
ctgattgtggcccacgcatcttccctcgaagcgtgtacctgtcagctccaaggtctatcc
ccgcagaactcaaaggacttcgtacaaatggtccggaagatcccatacctaggcttctgt
tcctgcgaagaattgggagaaactggaatatggcaactgacagacccgcccatccttccc
cttacccatggccccactgggggcttcaactggagagagaccctcctgcaagaataa

DBGET integrated database retrieval system