KEGG   Mus musculus (mouse): 72962Help
Entry
72962             CDS       T01002                                 

Gene name
Tymp, 2900072D10Rik, Ecgf1, PD-ECGF, PDECGF, Pdgfec
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmu  Mus musculus (mouse)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    72962 (Tymp)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    72962 (Tymp)
 Human Diseases
  Cancers
   05219 Bladder cancer
    72962 (Tymp)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     72962 (Tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 F1; 15 44.86 cM
AA seq 471 aa AA seqDB search
MAAPGTPPPSASGGGGGEPRQLPELIRLKRDGGHLREADIRNFVHAVIDGRAQDTQIGAM
LMAIRLQGMNLEETSVLTRALAESGQQLEWPKAWHQQLVDKHSTGGVGDKVSLVLAPALA
ACGCKVPMISGRSLGHTGGTLDKLESIPGFGVTQSPEQMLHILEEVGCCIVGQSAKLVPA
DGILYAARDVTATVDSVPLITASILSKKAVEGLSTLVVDVKFGGAAVFPDQEKARELAKM
LVRVGVSLGLKVAAALTAMDNPLGRSVGHTLEVEEALLCLDGAGPPDLRDLVIRLGGAIL
WISGQAETQDQGAARVAAALDDGSARRRFQLMLSAQGVDPGLAKALCSGSPTQRRQLLPH
AREQEELLAPADGIVECVRALPLARVLHDLGAGRSRAGQPIRPGVGAEVLVDVGQCLSRG
TPWLRVHLDGPALSSQQRRTLQGALVLSDRAPFKVPSPFAELVLPPTIAQP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccagggacaccacctccctcggcctcagggggaggaggtggggagcccagg
cagctgcctgagctgatccgcctgaagcgagatggagggcatctgagagaagcagatatc
agaaacttcgtgcacgcggtgatagatggaagagcacaggacacacaaattggggccatg
ctaatggccattcggctgcagggaatgaacctagaagagacatctgtgctgactcgggcc
cttgcagagtctgggcagcaactggagtggcccaaagcctggcaccagcagcttgttgac
aaacactccacaggaggtgtgggtgacaaggttagcctggttctggcacctgccctggct
gcatgcggctgtaaggtgccaatgatcagcggccgcagtctgggacacacagggggcaca
ctggataagctggaatcgattcctgggttcggtgtcacccagagcccagagcagatgctg
cacatccttgaggaagtcggctgctgcattgtcggccagagtgcaaagctggttcctgct
gatgggatcctgtatgctgcacgagatgtgacagccactgtggacagtgtcccactcatt
acagcttcaatcctcagtaagaaggccgtggagggactgtccactctggtggtagatgtt
aagtttgggggagctgcagtcttcccagaccaggagaaggcccgagaactggcaaagatg
ttggttagagtgggagtgagcctggggctgaaggtcgccgcagccctgaccgccatggat
aaccctctgggccgcagcgtgggccataccctggaggtggaagaagcgttgctttgcctg
gatggtgcggggccgccggatctgcgggacctggtcattaggctaggaggcgccattctt
tggattagcggacaggcggaaacacaagaccaaggcgccgcccgagtggccgcggcgttg
gatgacggctccgcgcggcgccgcttccagctgatgctttcggcgcagggcgtggacccc
ggcctagctaaagcattgtgctccgggagccccacgcaacgccggcagctgctgcctcac
gcccgagagcaagaggagctgctcgcaccggcagacggcattgttgagtgcgtccgagcg
ctgccgctggcccgtgtgctgcacgacctcggagccggacgcagccgagcggggcagccg
atcagaccgggagtgggtgccgaggtactggtcgacgtgggccagtgtttgtcccgaggg
acaccctggctccgcgtgcacctagacggccctgcgctcagcagtcagcagcgacgcact
ctccagggggcgctcgtgctatcagatcgagcacccttcaaggtcccttcacccttcgct
gaacttgtcctcccaccgaccatcgcacagccctaa

DBGET integrated database retrieval system