KEGG   Mus musculus (mouse): 73086Help
Entry
73086             CDS       T01002                                 

Gene name
Rps6ka5, 3110005L17Rik, 6330404E13Rik, AI854034, MSK1, MSPK1, RLPK
Definition
(RefSeq) ribosomal protein S6 kinase, polypeptide 5 (EC:2.7.11.1)
  KO
K04445  
ribosomal protein S6 kinase alpha-5 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Circadian entrainment
Neurotrophin signaling pathway
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    73086 (Rps6ka5)
   04668 TNF signaling pathway
    73086 (Rps6ka5)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    73086 (Rps6ka5)
  Nervous system
   04722 Neurotrophin signaling pathway
    73086 (Rps6ka5)
  Environmental adaptation
   04713 Circadian entrainment
    73086 (Rps6ka5)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    73086 (Rps6ka5)
   05219 Bladder cancer
    73086 (Rps6ka5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     73086 (Rps6ka5)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   73086 (Rps6ka5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12; 12 E
AA seq 863 aa AA seqDB search
MEGEGGGSGGAGTSGDSGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYG
KVFLVRKISGHDAGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAF
QTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLE
NILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWSL
GVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSTVAKDLLQRLLMKDPKKR
LGCGPRDAEEIKEHLFFEKIKWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSP
AALPQSSERLFQGYSFVAPSILFKRNAAVIDPLQFHMGVDRPGVTNVARSAMMKDSPFYQ
HYDLDLKDKPLGEGSFSICRKCVHKKTNQAFAVKIISKRMEANTQKEITALKLCEGHPNI
VKLHEVFHDQVAASAQPPGQVVLCSLLLLALLFNRSLTRKPVTWTWLVHSTSQLPPLPPP
MPEIVLFILLSDNGQLHTFLVMELLNGGELFERIKRKKHFSETEASYIMRKLVSAVSHMH
DVGVVHRDLKPENLLFTDENDNLEIKVIDFGFARLKPPDNQPLKTPCFTLHYAAPELLTH
NGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNV
SQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVK
ATFHAFNKYKREGFCLQNVDKAPLAKRRKMKRTSTSTETRSSSSESSRSSSSQSHGKTTP
TKTLQPSNPTEGSNPDTLFQFSD
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggagggggagggcggcggcagcggcggcgcgggcaccagcggggacagcggcgacggc
ggcgagcagctccttactgtcaagcacgagctgcggaccgccaacttaacaggacacgca
gagaaggtggggattgaaaactttgagctgctgaaggtcctaggaactggagcttatggg
aaagtatttctagttcgtaaaataagcggccatgatgctggaaagctgtatgctatgaag
gttttaaaaaaggcaacaatagttcagaaggctaaaactacagagcatacaaggacagaa
cgacaggttctggagcacattagacagtcgccatttttggtgacattgcactatgctttc
cagacagagaccaagcttcatctcatcttagattatataaatggtggagaactttttact
catctttctcaaagagagcgtttcacagagcacgaagtgcagatctatgttggagagatt
gtgcttgccctggaacacctgcacaagttggggattatataccgtgacattaagcttgaa
aatattctcctggattctaacggccatgtggtgctgacagatttcggtctgagtaaggag
tttgtggccgatgaaactgaaagagcatattctttttgtggaactattgaatacatggct
ccagatattgtcagagggggtgattcgggacacgacaaggcagttgactggtggagctta
ggtgttctaatgtatgagctactaactggagcatctcctttcactgtcgatggagaaaaa
aattcccaggctgagatatctaggagaattttaaaaagtgagcctccgtatccccaggaa
atgagcacagtagctaaagacctacttcagcgtctcttgatgaaagatcccaagaagcga
ttgggatgtggcccacgggatgcagaagaaatcaaagaacatctcttctttgagaagata
aagtgggatgacttagctgccaaaaaagtgcctgcgccattcaagccggtgatccgggat
gagttagatgtgagtaacttcgctgaagagttcacagagatggaccccacctactctccc
gctgccttgccacagagctccgagcgactgtttcagggctattccttcgttgctccatct
attctcttcaagcgtaacgcagctgtcatagatcctcttcagttccatatgggagttgac
cgtcctggagtgacaaatgttgccaggagtgcaatgatgaaggactcacccttctatcaa
cactatgacctagatctgaaggacaaacctttgggagaaggaagtttttcaatttgtcgc
aagtgtgtacacaaaaaaactaaccaagcatttgctgtcaaaataatcagcaaaaggatg
gaagccaatactcagaaagaaataacagctctgaaactctgcgaaggacaccccaatatt
gtgaaactacatgaagtttttcacgatcaggtggcagcgtctgctcagcccccaggacag
gttgttctatgctctcttctactcttagctctgcttttcaacagaagtctcacacggaag
cctgtcacttggacatggctggtccatagcacctctcagctccctccattgccacctccc
atgcctgaaattgtgctatttattcttctctctgataatggacagcttcatacgtttctt
gtgatggaacttctgaatggcggagagctgttcgagcgcatcaagagaaagaagcacttc
agcgagactgaggccagctacatcatgcggaagcttgtgtcagctgtgagccacatgcac
gatgtaggagtggtgcacagagatctgaagcctgagaatctgttgttcactgatgaaaac
gacaatttggaaattaaagtgattgactttgggtttgcacgcctcaagccacctgacaat
cagcccctcaagaccccgtgcttcaccctccactacgcagcaccggagctcttgacgcac
aatggctacgatgagtcctgtgacctgtggagcttgggtgtcatcctgtatacaatgctg
tcagggcaggtgccattccagtctcatgacagaagtttaacatgcaccagtgcagtggaa
atcatgaagaaaattaaaaagggagacttctcctttgaaggagaagcgtggaagaatgta
tcccaagaggctaaagatttgattcaagggcttcttacagttgatccaaataaaaggctg
aaaatgtctggtttgagatacaatgaatggcttcaggatggcagtcagctgtcctccaat
cctctgatgactccagacattctgggatcgtcaggagcagctgtgcacacctgtgtgaaa
gcaacctttcatgcctttaacaagtataagagagaaggattttgcctgcagaatgtggat
aaggcccctttggctaagaggaggaaaatgaagaggaccagcaccagcacagagactcgc
agcagctccagcgagagctcccgctcctcctcctcccagtcccacggcaagacaacgcct
accaagacgctgcagcccagcaatcccaccgaaggcagtaacccagacaccctcttccag
ttctcagactga

DBGET integrated database retrieval system