KEGG   Mus musculus (mouse): 73750Help
Entry
73750             CDS       T01002                                 

Gene name
Whrn, 1110035G07Rik, AW122018, AW742671, C430046P22Rik, Dfnb31, Ush2d, wi
Definition
(RefSeq) whirlin
  KO
K21879  whirlin
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    73750 (Whrn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_2 CCM2_C
Motif
Other DBs
NCBI-GeneID: 73750
NCBI-ProteinID: NP_001008791
MGI: 2682003
Ensembl: ENSMUSG00000039137
Vega: OTTMUSG00000000249
UniProt: Q80VW5
Position
4 33.97 cM; 4 C1
AA seq 918 aa AA seqDB search
MNAQLDGLSVSSSSTGSLGSAAAAAGGGGGAGLRLLSANVRQLHQALTALLSEPEREQFT
HCLNAYHARRNVFDLVRTLRVLLDSPVKRRLLPMLRLVIPRSDQLLFDQYTAEGLYLPAT
TPYRQPAWAAPDGAGPGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEK
EGLRVGDQILRVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRIPGGYVTNHIYTWVDP
QGRSTSPPSSLPQPHGSTLRQREDDRRSTLHLLQSGDEKKVNLVLGDGRSLGLTIRGGAE
YGLGIYITGVDPGSEAESSGLKVGDQILEVNGRSFLNILHDEAVKLLKSSRHLILTVKDV
GRLPHARTTVDQTKWIASSRIGESVANSAGFPGDHTEEGTSKPGFYKGPAGSQVTLSSLG
NQTRALLDDQARHLLTEQERATMMYYLAQYRGGTISVEAMVMALFELLNTHAKFSLLSEV
RSIISPQDLDRFDHLVLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVS
SARERLLWLIDLMENTLDLEGTGETTQGSTNALPDVSVDDVKSPSEDLPGIKPPPPPPPL
AQGHDRLLGQPRKPGREDPAPLSSAAHSGIVFSAPRNRSPPPGTAPTPGPSSAQDSPSSP
IYASISHANPSSRKPLDTHLALVNQHPIGPFPRVQSPPHLKSPPAETPGAGACLPPPSPS
EHPDAVGANQHFVLVEVHRPDSEPDVNEVRALPQTRTASTLSQLSDSGQTLSEDSGVDAG
ETEASTSGRGRQTASAKNKNGKEQPRTERTAEGANKPPGLLEPTSTLVRVRKSAATLGIA
IEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGQTLRGKEHKEAARIIAEAFK
TKERDYIDFLVTEFNVML
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacagctggacggcctgtcggtgagctcgtcctccaccggctcgctgggctcg
gcggcggcggcggcgggcggcggcgggggcgcggggttgcggctgctgtctgccaacgtg
cgccagctgcaccaagcgctcacggcgctgctgagcgagcccgagcgggagcagttcact
cactgcctcaacgcgtaccacgcgcgccgcaacgtcttcgacctggtgcgcaccctgcgc
gtcctgctggacagcccggtcaagcggcgtctgctgcccatgctgcgtctggtcatcccg
cgctccgaccagctgctcttcgaccagtacacggccgagggcctctacctgccagccacc
accccctacaggcagcccgcctgggccgctcccgacggcgcggggcccggggaggtgcga
ctcgtgagcctgcggcgcgccaaggcccacgagggcttgggcttcagcatccgcgggggc
tcggaacacggcgtgggcatctacgtgtctctagtggagccgggctccctggcagagaag
gaagggttgcgggtcggggaccagattctgcgcgtcaacgataaatctctagcccgggtg
acccacgcggaggctgtcaaggctctcaaaggctccaagaagctggtgctgtctgtatac
tcagctgggcgtatcccagggggctatgtgaccaaccacatctacacctgggtggaccca
cagggtcgaagcacatcccctccctccagcctgccccagccccatggcagcaccctgaga
cagcgtgaagatgaccgaaggagtaccctccacctcctgcagagtggagatgagaaaaag
gtgaacctggtgttgggggacggccggtccttgggcctcacgatccgaggtggagcagag
tacggccttggcatttacatcactggtgtggacccaggctctgaagcagagagcagcggc
ctcaaggttggagaccagattctggaggtgaatgggcggagctttctcaacatcctgcat
gatgaggcagtgaagctgctcaagtcatcccggcacctcatcctgacggtgaaggacgtc
ggaaggctgccccacgcacgtaccaccgtggaccagaccaagtggatcgccagttcccgg
atcggggaaagcgtcgccaactcagcagggtttccaggggaccacacagaagaagggaca
agcaagccaggattttacaagggcccagccggctcccaggtgaccctgagcagcctgggg
aatcagactcgtgcactgctggacgaccaagccaggcacctgctgacagagcaggagcgc
gccaccatgatgtactacctggcccagtaccgtggtggcaccatctctgtggaggccatg
gtcatggcactgtttgagttgctcaacacacacgccaagttctcactcctgtctgaggtg
agaagcatcatctcaccccaagacctggaccgctttgaccacctggtgctgaggcgcgag
atcgagtctatgaaggcgaggcagccccccggccccggggttggagacacgtattccatg
gtttcctacagcgacacaggctcatccacaggcagccacggcacctctacaaccgtcagc
tcggccagggagcggctgctgtggcttatagacctgatggagaatacattagacctggaa
ggaaccggtgagaccacccagggcagcaccaacgctctcccggatgtgtctgtggatgat
gtcaaatccccctcagaagatctgcctggtatcaagccacctcctcccccaccacccctg
gctcaaggtcatgaccgcttgcttggccagccacggaagccagggagggaggaccccgca
cctctgtcttctgctgcccactcaggcattgtcttctcagcaccacggaaccgcagcccg
ccgccagggactgctcccactccgggaccttcctcagcacaggactctccctcctccccc
atttatgcctccatctcccatgccaaccccagttccagaaagccgctggacacccacctg
gccctggttaaccagcaccccatcggccccttccctcgagtccagtccccacctcacctg
aagagccctcctgcagagaccccaggagctggggcctgccttccaccaccatcaccctct
gaacaccctgacgccgtgggtgcaaaccagcactttgttctggtggaggtgcaccgtccg
gacagtgagcctgatgtgaatgaagtgcgggctctgccccagactcgcacagcctccaca
ctctctcagctctcagacagtgggcagaccctgagcgaggacagtggcgtggatgccggg
gagacggaggccagcacctcaggccgaggcagacagacagcatccgctaagaacaagaat
ggcaaggagcagccccggacggagaggaccgcggagggtgccaacaaacctcccggcctg
ctggagccaacgtccaccctggtccgtgtgaggaaaagtgcagccacactgggcatcgcc
attgagggcggtgccaacacacgccagcctctgcccaggatcgtcacaattcagcgagga
ggttctgcccataactgtggacagctcaaggtgggccacgtaattctggaagtgaatggg
cagacacttcggggtaaggagcacaaggaggccgcccgaatcatcgctgaggccttcaag
accaaggagagagactacatcgactttctggtcactgagttcaacgtgatgctctag

DBGET integrated database retrieval system