KEGG   Mus musculus (mouse): 73750Help
Entry
73750             CDS       T01002                                 

Gene name
Whrn, 1110035G07Rik, AW122018, AW742671, C430046P22Rik, Dfnb31, wi
Definition
whirlin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C1; 4 33.97 cM
AA seq 918 aa AA seqDB search
MNAQLDGLSVSSSSTGSLGSAAAAAGGGGGAGLRLLSANVRQLHQALTALLSEPEREQFT
HCLNAYHARRNVFDLVRTLRVLLDSPVKRRLLPMLRLVIPRSDQLLFDQYTAEGLYLPAT
TPYRQPAWAAPDGAGPGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEK
EGLRVGDQILRVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRIPGGYVTNHIYTWVDP
QGRSTSPPSSLPQPHGSTLRQREDDRRSTLHLLQSGDEKKVNLVLGDGRSLGLTIRGGAE
YGLGIYITGVDPGSEAESSGLKVGDQILEVNGRSFLNILHDEAVKLLKSSRHLILTVKDV
GRLPHARTTVDQTKWIASSRIGESVANSAGFPGDHTEEGTSKPGFYKGPAGSQVTLSSLG
NQTRALLDDQARHLLTEQERATMMYYLAQYRGGTISVEAMVMALFELLNTHAKFSLLSEV
RSIISPQDLDRFDHLVLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVS
SARERLLWLIDLMENTLDLEGTGETTQGSTNALPDVSVDDVKSPSEDLPGIKPPPPPPPL
AQGHDRLLGQPRKPGREDPAPLSSAAHSGIVFSAPRNRSPPPGTAPTPGPSSAQDSPSSP
IYASISHANPSSRKPLDTHLALVNQHPIGPFPRVQSPPHLKSPPAETPGAGACLPPPSPS
EHPDAVGANQHFVLVEVHRPDSEPDVNEVRALPQTRTASTLSQLSDSGQTLSEDSGVDAG
ETEASTSGRGRQTASAKNKNGKEQPRTERTAEGANKPPGLLEPTSTLVRVRKSAATLGIA
IEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGQTLRGKEHKEAARIIAEAFK
TKERDYIDFLVTEFNVML
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacagctggacggcctgtcggtgagctcgtcctccaccggctcgctgggctcg
gcggcggcggcggcgggcggcggcgggggcgcggggttgcggctgctgtctgccaacgtg
cgccagctgcaccaagcgctcacggcgctgctgagcgagcccgagcgggagcagttcact
cactgcctcaacgcgtaccacgcgcgccgcaacgtcttcgacctggtgcgcaccctgcgc
gtcctgctggacagcccggtcaagcggcgtctgctgcccatgctgcgtctggtcatcccg
cgctccgaccagctgctcttcgaccagtacacggccgagggcctctacctgccagccacc
accccctacaggcagcccgcctgggccgctcccgacggcgcggggcccggggaggtgcga
ctcgtgagcctgcggcgcgccaaggcccacgagggcttgggcttcagcatccgcgggggc
tcggaacacggcgtgggcatctacgtgtctctagtggagccgggctccctggcagagaag
gaagggttgcgggtcggggaccagattctgcgcgtcaacgataaatctctagcccgggtg
acccacgcggaggctgtcaaggctctcaaaggctccaagaagctggtgctgtctgtatac
tcagctgggcgtatcccagggggctatgtgaccaaccacatctacacctgggtggaccca
cagggtcgaagcacatcccctccctccagcctgccccagccccatggcagcaccctgaga
cagcgtgaagatgaccgaaggagtaccctccacctcctgcagagtggagatgagaaaaag
gtgaacctggtgttgggggacggccggtccttgggcctcacgatccgaggtggagcagag
tacggccttggcatttacatcactggtgtggacccaggctctgaagcagagagcagcggc
ctcaaggttggagaccagattctggaggtgaatgggcggagctttctcaacatcctgcat
gatgaggcagtgaagctgctcaagtcatcccggcacctcatcctgacggtgaaggacgtc
ggaaggctgccccacgcacgtaccaccgtggaccagaccaagtggatcgccagttcccgg
atcggggaaagcgtcgccaactcagcagggtttccaggggaccacacagaagaagggaca
agcaagccaggattttacaagggcccagccggctcccaggtgaccctgagcagcctgggg
aatcagactcgtgcactgctggacgaccaagccaggcacctgctgacagagcaggagcgc
gccaccatgatgtactacctggcccagtaccgtggtggcaccatctctgtggaggccatg
gtcatggcactgtttgagttgctcaacacacacgccaagttctcactcctgtctgaggtg
agaagcatcatctcaccccaagacctggaccgctttgaccacctggtgctgaggcgcgag
atcgagtctatgaaggcgaggcagccccccggccccggggttggagacacgtattccatg
gtttcctacagcgacacaggctcatccacaggcagccacggcacctctacaaccgtcagc
tcggccagggagcggctgctgtggcttatagacctgatggagaatacattagacctggaa
ggaaccggtgagaccacccagggcagcaccaacgctctcccggatgtgtctgtggatgat
gtcaaatccccctcagaagatctgcctggtatcaagccacctcctcccccaccacccctg
gctcaaggtcatgaccgcttgcttggccagccacggaagccagggagggaggaccccgca
cctctgtcttctgctgcccactcaggcattgtcttctcagcaccacggaaccgcagcccg
ccgccagggactgctcccactccgggaccttcctcagcacaggactctccctcctccccc
atttatgcctccatctcccatgccaaccccagttccagaaagccgctggacacccacctg
gccctggttaaccagcaccccatcggccccttccctcgagtccagtccccacctcacctg
aagagccctcctgcagagaccccaggagctggggcctgccttccaccaccatcaccctct
gaacaccctgacgccgtgggtgcaaaccagcactttgttctggtggaggtgcaccgtccg
gacagtgagcctgatgtgaatgaagtgcgggctctgccccagactcgcacagcctccaca
ctctctcagctctcagacagtgggcagaccctgagcgaggacagtggcgtggatgccggg
gagacggaggccagcacctcaggccgaggcagacagacagcatccgctaagaacaagaat
ggcaaggagcagccccggacggagaggaccgcggagggtgccaacaaacctcccggcctg
ctggagccaacgtccaccctggtccgtgtgaggaaaagtgcagccacactgggcatcgcc
attgagggcggtgccaacacacgccagcctctgcccaggatcgtcacaattcagcgagga
ggttctgcccataactgtggacagctcaaggtgggccacgtaattctggaagtgaatggg
cagacacttcggggtaaggagcacaaggaggccgcccgaatcatcgctgaggccttcaag
accaaggagagagactacatcgactttctggtcactgagttcaacgtgatgctctag

DBGET integrated database retrieval system