KEGG   Mus musculus (mouse): 73991Help
Entry
73991             CDS       T01002                                 

Gene name
Atl1, 4930435M24Rik, Adfsp, Fsp1, Spg3, Spg3a
Definition
(RefSeq) atlastin GTPase 1
  KO
K17339  
atlastin [EC:3.6.5.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     73991 (Atl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12; 12 C2
AA seq 558 aa AA seqDB search
MAKSRRDRNSWGGFSEKSSDWSSEEEEPVRKAGPVQVLIVKDDHSFELDEAALNRILLSQ
AVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERET
TGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQ
NVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRL
KVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKIL
IPWLLSPERLDIKEINGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAV
ATAKDTYNKKMEEVCGGDKPFLAPNDLQSKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQ
LESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI
MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLCHQ
AFPAPKSEPTQQPEKKKI
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggctaagagccgcagggacagaaacagttggggtgggttttcagagaagtcaagtgac
tggagctcagaagaggaggagccagtgagaaaggcagggcctgtccaggtcctcatcgtc
aaggacgaccattcctttgagttagacgaggctgcgctgaaccgcatccttctgtcccag
gccgtcagagacaaggaggtggttgctgtgtctgttgctggagcctttagaaaagggaaa
tccttcctgatggacttcatgttgcggtacatgtacaaccaggaatctgttgattgggtt
ggagattacaatgaaccattgactggattttcatggaggggtggatcggaacgagaaacc
acaggaatccagatatggagtgaagttttcctcatcaataagcttgatggtaaaaaggtt
gcagtgttactgatggatactcagggaacctttgacagtcagtcaactttgagagattcg
gccacagtatttgcgcttagcacaatgataagctcaatacaggtctacaacttgtcccag
aatgtccaggaggatgatctccagcacctgcagcttttcactgagtatggcaggttggca
atggaagaaacattcctgaagccttttcagagtctgatatttcttgttcgagactggagt
ttcccatacgaattttcatatggagctgatggtggcgccaagttcttggaaaaacgcctc
aaggtctcagggaaccagcatgaagagctgcagaacgtcaggaagcacatccactcctgc
ttcaccaacatttcctgctttctcctacctcatcctggcttaaaagtcgctaccaaccca
aactttgatgggaaactaaaagaaatagatgatgaattcatcaaaaacttgaaaatactg
attccatggctcctgagtcctgagcgtctagatattaaagagatcaatgggaataaaatc
acctgccgaggcctgctggagtacttcaaggcatacataaagatataccaaggtgaagaa
ttgccgcatcccaagtccatgttacaggccacagcagaagctaacaatttagcagctgtt
gcaactgccaaggacacatacaacaagaagatggaagaggtttgtggtggtgataaacca
tttttggcccctaacgacctgcaaagcaagcacctgcagctaaaagaagaatctgtgaag
ttattccgaggcgtgaagaagatgggcggggaagagttcagccggcgttacctgcagcag
ctggagagtgaaatagatgaactctacatccagtatattaagcacaatgacagcaaaaat
atcttccatgctgctcgaaccccagccacactgttcgttgtcatctttatcacatacgtg
attgctggtgtgactggattcattggtttggacatcatagctagcctgtgcaacatgatc
atgggactgacgcttatcaccctctgcacctgggcatatatccgctactctggcgaatat
cgagagctgggtgctgtaatcgaccaggtagctgcagctttgtgggaccagggaagcaca
aatgaggcgttatacaagctttacagtgcagcagcaacccacagacacctgtgtcaccaa
gctttccctgcacccaagtcagagcctactcaacaaccggaaaagaagaaaatttaa

DBGET integrated database retrieval system