KEGG   Mus musculus (mouse): 74097Help
Entry
74097             CDS       T01002                                 

Gene name
Pop7, 0610037N12Rik, AI852017, Rpp20
Definition
processing of precursor 7, ribonuclease P family, (S. cerevisiae) (EC:3.1.26.5)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mmu03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:mmu03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5
AA seq 140 aa AA seqDB search
MAENREPRCAIEAELDPVEYTLRKRLPHRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGT
RGQNACTEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDSREP
LTRVRNNSAIHIRVFRVTPK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaacagagaaccccgctgtgccatcgaggctgagctggaccctgtggagtac
acccttcggaagcgacttccccaccgcttgccccggaggcccaacgacatttatgtcaac
atgaagactgactttaaggcccagctagctcgctgccaaaagctcctggacggaggcact
agggggcagaacgcatgcactgaaatctacattcatggcttgggcctggccatcaaccgg
gccatcaacatcgccctgcagctgcaggcgggcagctttgggtccctacaggtggccgcc
aatacctccaccgtggagctggtggacgagttggagccagagactgactctcgggagccc
ctgacgagggtcaggaacaactcagccatccacatccgagtcttcagggtcacgcccaag
taa

DBGET integrated database retrieval system