KEGG   Mus musculus (mouse): 74112Help
Entry
74112             CDS       T01002                                 

Gene name
Usp16, 1200004E02Rik, 2810483I07Rik, 6330514E22Rik, UBPM
Definition
(RefSeq) ubiquitin specific peptidase 16
  KO
K11844  ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     74112 (Usp16)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   74112 (Usp16)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    74112 (Usp16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH zf-UBP UCH_1 RbpA BRCT_assoc zinc_ribbon_10 DapB_C
Motif
Other DBs
NCBI-GeneID: 74112
NCBI-ProteinID: NP_077220
MGI: 1921362
Ensembl: ENSMUSG00000025616
Vega: OTTMUSG00000026485
UniProt: Q99LG0
Position
16; 16 C3.3
AA seq 825 aa AA seqDB search
MGKKRTKGRSAPDTVASESAEPVCRHLRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
PEEEAEDPSVWLCLKCGHQGCGRDSQEQHALKHYTTPRSEPHYLVLSLDNWSVWCYKCDE
EVKYCSSNRLGQVVDYVRKQAGVRTSKPAEKNNGHIELENKKLEKESKNEQEREKSENLA
KETIPMDSASQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDL
ALTEPLEVNLEPPGPLTLAMSQFLSEMQENKKRVVTPKELFSQVCKKATRFKGYQQQDSQ
ELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEEVKNKVKDYEKKKAIPSFVDRIFGG
ELTSTIMCDECRTVSLVHESFLDLSLPVLDDQSGKKSINDKNVKMTMEEEDKDSEEEKDD
SYMKSRSDLPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQERFLHFNELCATDYTEDNERE
ADTALAGEVEVDTDSTHGSQEEATQIELSVNQKDLDGQESMIERTPDVQESPEDLGVKSA
NTESDLGIVTPAPECPRDFNGAFLEERTSGELDIINGLKNLNLNAAVDPDEINIEIPNDS
HSAPKVYEVMNEDPETAFCTLANREAFSTDECSIQHCLYQFTRNEKLQDANKLLCEVCSR
RQCNGPKANIKGDRRHVYTNAKKQMLVSLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEI
LDLAPFCTLKCKNVAEESTRVLYSLYGVVEHSGTMRSGHYTAYAKERTASCHLSNLVLHG
DIPQDCEMESTKGQWFHISDTHVQAVPITKVLNSQAYLLFYERIL
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaacggaccaaggggagaagtgctccagacacggtggcctcagagtctgca
gaaccagtgtgcagacaccttagaaaagggttggaacaaggtaatttgaaaaaagcttta
gtaaatgtggagtggaatatctgccaagactgtaagactgacaataaagtgaaagataaa
cctgaggaggaagcagaagacccttcggtttggctctgtcttaaatgtggccatcagggc
tgtggcagagattctcaggagcagcatgccttgaagcactacacgacaccgagatccgag
cctcactacctggtgctcagtctggacaactggagcgtctggtgctacaagtgtgacgag
gaagtcaagtactgtagctcaaaccgattgggccaagtggttgattatgttagaaaacaa
gctggcgtaagaacttcaaaaccagcagagaaaaataatggacacattgagctcgaaaat
aaaaaattggagaaagagagtaaaaatgaacaagagagagagaaatcggaaaacctggct
aaagaaactattcccatggactctgcttcccagataactgtgaaaggactcagtaatttg
gggaatacttgtttcttcaatgcagttatgcagaacttgtcacaaacgccagtgcttaga
gaactactaaaagaagtgaagatgtctggaacgattgtaaaaatagagccacctgatctg
gcactaacagaacctttagaagtaaacctcgagcctccaggtcctcttactttagccatg
agccagtttctcagtgagatgcaagagaacaaaaagcgagttgtgacacctaaagagctc
ttttctcaggtctgtaaaaaagcaacacgttttaaagggtaccagcaacaagacagccag
gagctgcttcgctacctactggatgggatgagagcggaagaacaccaaagagtgagtaaa
ggaattcttaaagcatttggtaattctactgaaaaattggatgaagaagtaaaaaataaa
gttaaagattatgaaaagaaaaaggcaatcccgagttttgtggaccgcatctttggtggc
gagctgactagtacgatcatgtgtgatgaatgcaggactgtctccttagtgcatgaatcg
ttccttgatttgtctcttccagttttagatgatcagagtggtaagaaaagtataaatgat
aaaaatgtgaaaatgacaatggaggaagaagataaagacagtgaggaagagaaagatgac
agctacatgaaatcaaggagcgatcttccgtcagggacaagcaagcacctacagaaaaag
gcaaagaagcaggccaaaaagcaggccaagaaccaacgaaggcaacaaaaaattcaagaa
agatttcttcacttcaatgagctctgcgccactgactacacggaagacaatgaacgtgaa
gctgacacagcacttgcgggagaagtggaagtggataccgactccacccatggttctcaa
gaggaggccacacagatagagctgtctgttaaccagaaggatttggatggccaagagagc
atgatagaaaggacacctgatgtgcaggaaagcccagaggacctaggagtgaaaagtgct
aacaccgagagtgatctggggattgtgacgcctgctcctgaatgtcctagggatttcaat
ggtgccttcctggaagaaaggaccagtggagaactagacattatcaatggtttaaaaaac
cttaatttgaatgctgctgttgatcctgatgaaataaatatagagattccgaatgacagt
cattctgcacccaaggtatatgaggtcatgaacgaggacccagaaactgctttctgtacc
ctcgcgaaccgagaagcgtttagtactgatgagtgttccattcaacattgcttatatcag
ttcacccggaatgagaaacttcaagatgccaataaactgctttgtgaagtgtgttcaaga
cggcagtgtaatggaccaaaggcaaatataaaaggtgacaggagacatgtttacaccaat
gccaagaagcagatgctggtctccctcgcgcctcctgtcctcactctgcatttaaagcga
ttccagcaggctggttttaacctgcgcaaagttaacaaacacataaagtttccagaaatc
ttagatttggctcctttttgtacccttaaatgtaagaatgttgctgaagaaagtacacga
gtgctgtattccttatatggagttgttgaacacagtggtactatgaggtcagggcattac
actgcctatgcgaaggagagaactgcaagctgtcacctctccaatcttgttcttcacggt
gacattccacaagattgtgaaatggaatcaaccaaagggcagtggtttcacatcagcgat
acacatgtgcaagctgtgcctataactaaagtactgaactcacaagcgtatctcctattt
tatgagagaatactgtga

DBGET integrated database retrieval system