KEGG   Mus musculus (mouse): 74112Help
Entry
74112             CDS       T01002                                 

Gene name
Usp16, 1200004E02Rik, 2810483I07Rik, 6330514E22Rik, UBPM
Definition
ubiquitin specific peptidase 16 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     74112 (Usp16)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   74112 (Usp16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 C3.3; 16
AA seq 825 aa AA seqDB search
MGKKRTKGRSAPDTVASESAEPVCRHLRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
PEEEAEDPSVWLCLKCGHQGCGRDSQEQHALKHYTTPRSEPHYLVLSLDNWSVWCYKCDE
EVKYCSSNRLGQVVDYVRKQAGVRTSKPAEKNNGHIELENKKLEKESKNEQEREKSENLA
KETIPMDSASQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDL
ALTEPLEVNLEPPGPLTLAMSQFLSEMQENKKRVVTPKELFSQVCKKATRFKGYQQQDSQ
ELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEEVKNKVKDYEKKKAIPSFVDRIFGG
ELTSTIMCDECRTVSLVHESFLDLSLPVLDDQSGKKSINDKNVKMTMEEEDKDSEEEKDD
SYMKSRSDLPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQERFLHFNELCATDYTEDNERE
ADTALAGEVEVDTDSTHGSQEEATQIELSVNQKDLDGQESMIERTPDVQESPEDLGVKSA
NTESDLGIVTPAPECPRDFNGAFLEERTSGELDIINGLKNLNLNAAVDPDEINIEIPNDS
HSAPKVYEVMNEDPETAFCTLANREAFSTDECSIQHCLYQFTRNEKLQDANKLLCEVCSR
RQCNGPKANIKGDRRHVYTNAKKQMLVSLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEI
LDLAPFCTLKCKNVAEESTRVLYSLYGVVEHSGTMRSGHYTAYAKERTASCHLSNLVLHG
DIPQDCEMESTKGQWFHISDTHVQAVPITKVLNSQAYLLFYERIL
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaacggaccaaggggagaagtgctccagacacggtggcctcagagtctgca
gaaccagtgtgcagacaccttagaaaagggttggaacaaggtaatttgaaaaaagcttta
gtaaatgtggagtggaatatctgccaagactgtaagactgacaataaagtgaaagataaa
cctgaggaggaagcagaagacccttcggtttggctctgtcttaaatgtggccatcagggc
tgtggcagagattctcaggagcagcatgccttgaagcactacacgacaccgagatccgag
cctcactacctggtgctcagtctggacaactggagcgtctggtgctacaagtgtgacgag
gaagtcaagtactgtagctcaaaccgattgggccaagtggttgattatgttagaaaacaa
gctggcgtaagaacttcaaaaccagcagagaaaaataatggacacattgagctcgaaaat
aaaaaattggagaaagagagtaaaaatgaacaagagagagagaaatcggaaaacctggct
aaagaaactattcccatggactctgcttcccagataactgtgaaaggactcagtaatttg
gggaatacttgtttcttcaatgcagttatgcagaacttgtcacaaacgccagtgcttaga
gaactactaaaagaagtgaagatgtctggaacgattgtaaaaatagagccacctgatctg
gcactaacagaacctttagaagtaaacctcgagcctccaggtcctcttactttagccatg
agccagtttctcagtgagatgcaagagaacaaaaagcgagttgtgacacctaaagagctc
ttttctcaggtctgtaaaaaagcaacacgttttaaagggtaccagcaacaagacagccag
gagctgcttcgctacctactggatgggatgagagcggaagaacaccaaagagtgagtaaa
ggaattcttaaagcatttggtaattctactgaaaaattggatgaagaagtaaaaaataaa
gttaaagattatgaaaagaaaaaggcaatcccgagttttgtggaccgcatctttggtggc
gagctgactagtacgatcatgtgtgatgaatgcaggactgtctccttagtgcatgaatcg
ttccttgatttgtctcttccagttttagatgatcagagtggtaagaaaagtataaatgat
aaaaatgtgaaaatgacaatggaggaagaagataaagacagtgaggaagagaaagatgac
agctacatgaaatcaaggagcgatcttccgtcagggacaagcaagcacctacagaaaaag
gcaaagaagcaggccaaaaagcaggccaagaaccaacgaaggcaacaaaaaattcaagaa
agatttcttcacttcaatgagctctgcgccactgactacacggaagacaatgaacgtgaa
gctgacacagcacttgcgggagaagtggaagtggataccgactccacccatggttctcaa
gaggaggccacacagatagagctgtctgttaaccagaaggatttggatggccaagagagc
atgatagaaaggacacctgatgtgcaggaaagcccagaggacctaggagtgaaaagtgct
aacaccgagagtgatctggggattgtgacgcctgctcctgaatgtcctagggatttcaat
ggtgccttcctggaagaaaggaccagtggagaactagacattatcaatggtttaaaaaac
cttaatttgaatgctgctgttgatcctgatgaaataaatatagagattccgaatgacagt
cattctgcacccaaggtatatgaggtcatgaacgaggacccagaaactgctttctgtacc
ctcgcgaaccgagaagcgtttagtactgatgagtgttccattcaacattgcttatatcag
ttcacccggaatgagaaacttcaagatgccaataaactgctttgtgaagtgtgttcaaga
cggcagtgtaatggaccaaaggcaaatataaaaggtgacaggagacatgtttacaccaat
gccaagaagcagatgctggtctccctcgcgcctcctgtcctcactctgcatttaaagcga
ttccagcaggctggttttaacctgcgcaaagttaacaaacacataaagtttccagaaatc
ttagatttggctcctttttgtacccttaaatgtaagaatgttgctgaagaaagtacacga
gtgctgtattccttatatggagttgttgaacacagtggtactatgaggtcagggcattac
actgcctatgcgaaggagagaactgcaagctgtcacctctccaatcttgttcttcacggt
gacattccacaagattgtgaaatggaatcaaccaaagggcagtggtttcacatcagcgat
acacatgtgcaagctgtgcctataactaaagtactgaactcacaagcgtatctcctattt
tatgagagaatactgtga

DBGET integrated database retrieval system