KEGG   Mus musculus (mouse): 74134Help
Entry
74134             CDS       T01002                                 

Gene name
Cyp2s1, 1200011C15Rik, AU041727, C79779
Definition
cytochrome P450, family 2, subfamily s, polypeptide 1 (EC:1.14.14.1)
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    74134 (Cyp2s1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    74134 (Cyp2s1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     74134 (Cyp2s1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   74134 (Cyp2s1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7
AA seq 501 aa AA seqDB search
MEAASTWALLLALLLLLLLLSLTLFRTPARGYLPPGPTPLPLLGNLLQLRPGALYSGLLR
LSKKYGPVFTVYLGPWRRVVVLVGHDAVREALGGQAEEFSGRGTLATLDKTFDGHGVFFA
NGERWKQLRKFTLLALRDLGMGKREGEELIQAEVQSLVEAFQKTEGRPFNPSMLLAQATS
NVVCSLVFGIRLPYDDKEFQAVIQAASGTLLGISSPWGQAYEMFSWLLQPLPGPHTQLQH
HLGTLAAFTIQQVQKHQGRFQTSGPARDVVDAFLLKMAQEKQDPGTEFTEKNLLMTVTYL
LFAGTMTIGATIRYALLLLLRYPQVQQRVREELIQELGPGRAPSLSDRVRLPYTDAVLHE
AQRLLALVPMGMPHTITRTTCFRGYTLPKGTEVFPLIGSILHDPAVFQNPGEFHPGRFLD
EDGRLRKHEAFLPYSLGKRVCLGEGLARAELWLFFTSILQAFSLETPCPPGDLSLKPAIS
GLFNIPPDFQLRVWPTGDQSR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagccagcacctgggcgctgctgctggccctgctgctgctgctgctgctgctg
tctctgacgctattcaggaccccggcccgaggctacctacccccggggcccacgccgctg
ccgttgctggggaacctcctgcagctgcgtcccggggctctgtactcggggcttttgcgg
ctaagtaagaagtatgggcctgtgttcacggtatacctgggcccctggcgccgcgtggtg
gtcctggttggacatgatgctgtaagagaagccttgggaggtcaggctgaggaattcagc
gggcgtggaacattggcaacgctggacaagacctttgatggtcacggagttttctttgcc
aatggggagcggtggaaacagctgaggaaattcaccctgctcgctctacgggacctgggc
atgggcaagcgagaaggcgaggagctgatccaggcggaggtgcagagtctggtggaggct
ttccagaagacagaaggacgtccattcaacccttccatgctgctggcccaggccacctct
aatgtcgtctgttcccttgtctttggcatccgtttgccctatgacgataaagagttccag
gctgtgatccaggcagcaagtggtaccttgttagggatcagctctccatggggccaggcc
tacgagatgttctcctggctactgcagcccctgccaggcccccacacacagctccagcac
cacttgggcaccctggctgccttcactatccagcaggtacagaaacaccagggacgcttc
caaacctcaggtcctgcacgtgatgtcgttgacgccttcctgctaaagatggcacaggag
aaacaagacccaggtacagaattcaccgagaagaacttgctgatgacggtcacatacctg
ctgtttgctgggaccatgaccatcggtgccaccatccgctatgccctcctgctcctgctg
agataccctcaagtccagcagcgcgtccgggaggagctcatacaggagctgggtcctggc
agggctccaagtctcagcgatcgagttcgcctcccttacacggatgccgttttacacgag
gcacagcggctcctggcactggtacccatgggcatgccccacaccatcacgaggaccact
tgcttccgagggtacactctgcccaagggcactgaggtcttccctctgattggctccata
ctgcatgaccctgcggttttccagaacccaggagagttccatccaggccgcttcctggac
gaagatggtcggttgagaaaacacgaagccttcctgccctactccttaggtaagcgagtc
tgcctgggagaaggcctggctcgggcggagttgtggcttttcttcacttccatcttgcaa
gccttctccctggagaccccgtgcccgccgggtgacctgagcctgaagccagccatcagt
ggacttttcaacatccccccggacttccagctgcgggtctggcccactggcgaccagtcc
agatga

DBGET integrated database retrieval system