KEGG   Mus musculus (mouse): 74137Help
Entry
74137             CDS       T01002                                 

Gene name
Nuak2, 1200013B22Rik, Omphk2, Snark, mKIAA0537
Definition
(RefSeq) NUAK family, SNF1-like kinase, 2 (EC:2.7.11.1)
  KO
K08800  
NUAK family, SNF1-like kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     74137 (Nuak2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   74137 (Nuak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 E4
AA seq 639 aa AA seqDB search
MESVALLQRPSQAPSASALASESARPLADGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFL
ETLGKGTYGKVKKARESSGRLVAIKSIRKDKIKDEQDLLHIRREIEIMSSLNHPHIIAIH
EVGRSRLVTVFENSSKIVIVMEYASRGDLYDYISERPRLSERDARHFFRQIVSALHYCHQ
NGIVHRDLKLENILLDANGNIKIADFGLSNLYHKGKFLQTFCGSPLYASPEIVNGKPYVG
PEVDSWSLGVLLYILVHGTMPFDGQDHKTLVKQISNGAYREPPKPSDACGLIRWLLMVNP
TRRATLEDVASHWWVNWGYTTGVGEQEALREGGHPSGDFGRASMADWLRRSSRPLLENGA
KVCSFFKQHVPGGGSTVPGLERQHSLKKSRKENDMAQNLQGDPAEDTSSRPGKSSLKLPK
GILKKKSSTSSGEVQEDPQELRPVPDTPGQPVPAVSLLPRKGILKKSRQRESGYYSSPEP
SESGELLDASDVFVSGDPVEQKSPQASGLLLHRKGILKLNGKFSRTALEGTTPSTFGSLD
QLASSHPAARPSRPSGAVSEDSILSSESFDQLDLPERLPETPLRGCVSVDNLRGLEQPPS
EGLKRWWQESLGDSCFSLTDCQEVTAAYRQALGICSKLS
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggtggccttactccagcgcccgagccaggctccctcggcctccgccctggcc
tcggagagcgcccggccgctggcggacgggctcatcaagtcgcctaaacctctgatgaag
aagcaggcggtgaagcggcaccatcacaaacacaacctgcggcaccgctacgagttcctg
gagacgctgggcaagggcacctacgggaaggtgaagaaggcacgagagagctcggggcgt
ctggtggccatcaagtccatcaggaaagacaaaatcaaagatgagcaggatctgctgcac
atacggagggagattgagatcatgtcttcactcaaccacccccacatcattgccatccat
gaagtgggcagatcacgcttagtgactgtgtttgagaatagcagcaagattgtgattgtc
atggagtatgccagccgaggcgatctgtatgattacatcagtgagcggccacggctgagt
gagcgggacgccaggcatttcttccgacagatcgtgtctgccctgcactactgccaccag
aacgggatcgttcaccgagatctcaagctggaaaacatccttctagatgccaatggaaac
atcaagattgctgactttggcctctccaacctgtaccacaaaggcaagttcctccagacg
ttctgtgggagccctctctacgcctcgcctgagatagtcaacgggaagccctatgtgggc
ccagaggtggacagctggtctctgggcgttctcctgtacatcctggtgcatggcaccatg
ccctttgacgggcaggatcataaaacactggtgaagcaaatcagtaacggggcttaccgt
gagccgcccaagccgtccgatgcctgtggcctgatccggtggctgttaatggtgaacccc
acccgtcgggccacactggaggatgtagccagtcattggtgggtcaactggggttacacc
accggagtcggggaacaggaagccctgcgtgagggtgggcaccctagtggtgactttggc
cgggcctccatggcggactggttacgtcgctcctcgcgccccctcctggagaatggagcc
aaggtgtgcagcttcttcaagcagcacgtgccgggaggtggaagcactgtacctgggctg
gagcggcaacattctcttaagaagtcccgaaaggagaatgacatggctcaaaatctgcaa
ggtgacccggctgaggatacctcttctcgccctggcaagagcagccttaagcttccgaaa
ggcattctcaagaaaaagtcctctacctcgtcaggggaggtacaggaggaccctcaggaa
ctcagaccggtgcctgatactccagggcagcctgtccctgctgtatccctgctcccaagg
aaaggcatccttaagaagtctcgacagcgtgaatctggttactactcctctccagagccc
agcgagtctggggaactcttagacgccagtgatgtgtttgtgagtggggaccccgtggag
cagaagtctccacaggcttcagggctcctcctccaccgcaagggcattctcaaactcaat
ggcaagttctcccgcacagccttagaaggcactacccctagcacctttggctccctggac
caactggcctcctcccatcctgcagcccggcccagccgcccctcaggggctgtgagtgag
gacagcatcctgtcctccgagtcctttgaccaattggacttgcctgaacgtcttcccgaa
accccactgaggggctgtgtgtctgtggacaacctgagggggcttgagcagcctccctca
gaaggtctgaagcgatggtggcaggaatccttgggggatagctgcttttctctgacagac
tgccaagaggtgactgcagcctacagacaagccctaggaatctgctcaaagctcagctga

DBGET integrated database retrieval system