KEGG   Mus musculus (mouse): 74147Help
Entry
74147             CDS       T01002                                 

Gene name
Ehhadh, 1300002P22Rik, HD, L-PBE, LBFP, LBP, MFP, MFP1, PBFE
Definition
enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase (EC:1.1.1.35 5.3.3.8 4.2.1.17)
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    74147 (Ehhadh)
   01212 Fatty acid metabolism
    74147 (Ehhadh)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    74147 (Ehhadh)
   00650 Butanoate metabolism
    74147 (Ehhadh)
  Lipid metabolism
   00071 Fatty acid degradation
    74147 (Ehhadh)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    74147 (Ehhadh)
   00310 Lysine degradation
    74147 (Ehhadh)
   00380 Tryptophan metabolism
    74147 (Ehhadh)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    74147 (Ehhadh)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    74147 (Ehhadh)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    74147 (Ehhadh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     74147 (Ehhadh)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     74147 (Ehhadh)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     74147 (Ehhadh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 B1; 16
AA seq 718 aa AA seqDB search
MAEYLRLPHSLAMIRLCNPPVNAISPTVITEVRNGLQKASLDHTVRAIVICGANDNFCAG
ADIHGFKSPTGLTLGSLVDEIQRYQKPVVAAIQGVALGGGLELALGCHYRIANAKARVGF
PEVMLGILPGARGTQLLPRVVGVPVALDLITSGRHISTDEALKLGILDVVVKSDPVEEAI
KFAQTVIGKPIEPRRILNKPVPSLPNMDSVFAEAIAKVRKQYPGRLAPETCVRSVQASVK
HPYEVAIKEEAKLFMYLRGSGQARALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGV
LGLGTMGRGIAISFARVGIPVVAVESDPKQLDTAKKIITSTLEKEASKSGQASAKPNLRF
SSSTKELSSVDLVIEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALDVDDIASSTDRP
QLVIGTHFFSPAHIMRLLEVIPSRYSSPTTIATVMSLSKRIGKIGVVVGNCYGFVGNRML
APYYNQGYFLIEEGSKPEDVDGVLEEFGFRMGPFRVSDLAGLDVGWKVRKGQGLTGPSLP
PGTPTRKRGNTRYSPIADMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSEFLSQYRE
THHIKQRSISKEEILERCLYSLINEAFRILEEGMAASPEHIDVIYLHGYGWPRHVGGPMY
YAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHSSKL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtatctgaggctgccccactccctggctatgatccgcctctgcaatccaccg
gtcaatgccatcagtccaactgtaatcacagaagtaaggaatggactccagaaagctagt
ttggaccatacggttagagccatagtgatctgtggagcaaatgacaacttctgtgcaggt
gctgatatccatggctttaaatctcccactggccttacattaggaagcttggtagatgaa
atacagcgataccagaagccagtggtggccgccatccaaggcgtggctcttggaggagga
ctagagctggccttgggctgtcactatcggattgccaatgcaaaggctcgtgttggcttc
ccggaagtgatgctgggaattcttcctggtgcaagaggaacgcagcttctacccagggtc
gttggagttcctgttgctcttgacttaattacctcaggaagacatatttcaacagatgaa
gcactcaagcttggaattctggatgtagttgtaaagtcagacccagttgaagaagccatc
aaatttgctcagacggttataggtaaacccatagaaccccgcaggatcctaaacaagcca
gtcccaagcttgcccaacatggacagtgtttttgcagaagccattgccaaggtacggaag
cagtaccctggccgcctggctccggagacttgtgtccgttcagtccaggcctccgtgaag
catccatatgaagtggccatcaaggaagaagcaaagctgtttatgtaccttcgggggtcg
gggcaggctagagccctgcagtacgccttttttgctgaaaagtctgcaaataagtggtca
actccctcaggagcatcttggaaaacagcatctgctcaacccgtctcctcggttggtgtt
cttggcttgggaacgatgggccgaggcatcgccatctcttttgcaagggtggggatccct
gtggttgctgtagagtcagacccaaagcagctagatactgcaaagaagataataacttcc
accttggaaaaggaagcatcgaagagtggccaagcttcagcaaaaccaaacctcaggttc
tcctcatccacaaaggagctttcgagtgtggatttagtgattgaagcagtgttcgaagat
atgaacctgaagaagaaggtcttcgctgaactgtcagccctgtgcaagccgggagccttt
ctgtgcaccaatacctcagcactggatgtggatgacattgcttcttccacagatcgcccc
cagctggtgattggcacccacttcttctccccagcccacatcatgaggttactagaggtc
attcctagccgatactcttcccccactaccatcgccacagtcatgagcttatccaaaagg
attggaaagattggagtcgttgttggtaactgctatggatttgttgggaatcgaatgttg
gctccctattacaaccagggctatttcttgatagaggaaggtagtaagccagaggatgta
gatggggtcttagaagagtttggttttagaatgggacccttcagggtgtctgacctcgca
gggctagatgtgggttggaaagttcgcaaagggcaaggccttactggaccgtccttacct
ccaggaacccccacccgaaagaggggcaataccaggtactccccaattgctgatatgctc
tgtgaagctgggcgatttggtcagaagacaggtaagggctggtatcagtatgacaagcca
ctgggtcgcatccacaaacctgatccctggctttctgagtttctgtcacagtatagagaa
acccatcacatcaagcagcgctccatcagcaaggaggaaatcctggagcgttgcttatat
tcccttatcaacgaggcattccgcatcttggaggaggggatggccgctagcccagagcac
attgatgtcatctacttgcatgggtatgggtggccaaggcacgtgggtgggcccatgtac
tatgctgcctcagttgggctgcccacagttctagagaaattgcagaaatattacagacag
aatcctgacatcccccagctggagcccagtgactacctgaggaggctggttgcccaggga
agccctcctctgaaagaatggcaaagcttggcaggaccccatagcagcaaactgtga

DBGET integrated database retrieval system