KEGG   Mus musculus (mouse): 74158Help
Entry
74158             CDS       T01002                                 

Gene name
Josd1, 1300006C06Rik, mKIAA0063
Definition
Josephin domain containing 1 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E1; 15
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKAESSDLPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKYHLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggagacaaggccaaagctgaatcctcggaccttccccaa
gcagcgcccccacaaatctaccatgagaagcagcgcagggagctctgtgctcttcatgct
ctcaacaacgtcttccaggacagcaacgccttcacgcgggaaacgctgcaggagattttc
cagaggctgtctccgaacactatggtgacgccccacaagaagagcatgctgggaaatggg
aactatgatgtgaatgtcatcatggcagcacttcaaaccaaaggctatgaagctgtttgg
tgggacaagcgaagggacgtgggtgtcattgctcttactaatgtcatgggcttcatcatg
aacctgccctccagcctctgctggggtccactcaagttgcctctcaaaagacagcactgg
atctgtgttcgtgaggtgggaggggcctactacaaccttgactccaaactcaagatgcca
gagtggattggaggcgagagtgagctcaggaaatttctaaaataccatttgcgaggtaaa
aactgtgaactcctactggttgtaccggaagaagtggaagcccatcagagctggagggcc
gacgtgtga

DBGET integrated database retrieval system