KEGG   Mus musculus (mouse): 74185Help
Entry
74185             CDS       T01002                                 

Gene name
Gbe1, 2310045H19Rik, 2810426P10Rik, D16Ertd536e
Definition
glucan (1,4-alpha-), branching enzyme 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    74185 (Gbe1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     74185 (Gbe1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   74185 (Gbe1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 C2; 16 40.19 cM
AA seq 702 aa AA seqDB search
MAAPAAPAAGETGPDARLEAALADVPELARLLEIDPYLKPFAADFQRRYKKFSQVLHDIG
ENEGGIDKFSRGYESFGIHRCSDGGIYCKEWAPGAEGVFLTGEFSGWNPFSHPYKKLEYG
KWELYIPPKQNKSPLIPHGSKLKVVITSKSGEILYRISPWAKYVVRENNNVNYDWIHWAP
EDPYKFKHSRPKKPRSLRIYESHVGISSHEGKIASYKHFTSNVLPRIKDLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGIVVLLDVVHSHASKNSEDGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFIYSSWEVLRFLLSNIRWWLEEYCFDGFRFDGVT
SMLYHHHGMGQGFSGDYNEYFGLQVDEDALIYLMLANHLAHTLYPDSITIAEDVSGMPAL
CSPTSQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGNIVYTLTNRRYLEKCVAYAESH
DQALVGDKTLAFWLMDAEMYTNMSVLAPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAP
QAYVSEKHEANKTITFERAGLLFIFNFHPSKSYTDYRVGTATPGKFKIVLDSDAAEYGGH
QRLDHNTNYFAEAFEHNGRPYSLLVYIPSRVALILQNVDLQN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccggcggctcctgcggcaggggaaacgggccccgatgctcgtctggaggcc
gccttggccgacgtgccggagctggcccgactcctggagattgacccgtacctgaagccc
ttcgccgcggacttccagcgcaggtataagaagtttagccaggttttgcatgacattgga
gagaatgaaggtgggatcgataagttctccagaggctatgagtcatttggcatccacaga
tgttctgatggtggcatctactgcaaagaatgggccccaggagcagaaggagtttttctt
actggagaattcagtggttggaatccattttctcacccatataaaaagctggaatacgga
aaatgggagctgtatatcccacccaagcagaacaaatcccccctgatacctcatgggtcc
aagctgaaggtagttattactagtaagagtggcgagatactgtatcgcatttccccatgg
gcaaagtatgtggttcgtgagaacaacaacgtgaactatgattggatacactgggctcca
gaagacccctataaattcaagcattccagacctaagaaaccaagaagcctaagaatttat
gaatctcatgtgggaatttcttcccacgaaggaaaaatagcttcttacaaacattttacc
agcaatgtactaccaagaatcaaagaccttgggtataactgcattcagttgatggcgatc
atggaacatgcttactatgccagttttgggtaccaaatcacgagcttttttgcagcttca
agtcgttatggaactcctgaagagctgaaagaacttgttgacacagcacattcgatgggc
attgtagtcctcctagatgtggttcatagccatgcttcaaaaaattcagaagatgggtta
aacatgtttgatgggaccgattcctgttattttcactctggaccccgagggacccatgat
ctttgggacagtagattatttatctattccagctgggaagttttaagattccttctgtcg
aacataagatggtggttggaggagtactgctttgatggcttccgttttgatggtgtcacc
tctatgctctatcatcaccacggaatgggtcaaggtttttcgggtgactataatgaatat
tttggactacaagtagatgaagatgctttgatttatctcatgttggcaaatcatttggct
cacacgttgtacccagactcgataacaatagcagaggatgtatcagggatgccggctctc
tgttctccaacttcccagggaggcggtggttttgactacagattagcaatggctattcca
gataaatggatccaattacttaaggaatttaaagatgaagactggaatatgggcaatata
gtgtatactctcaccaatcgacgctaccttgaaaaatgtgtggcttatgcagagagtcat
gatcaggcattggttggtgacaagacactggcgttttggttgatggacgctgagatgtac
acgaacatgagcgttctggcccctttcactccagtaattgatcgaggaatacagcttcat
aagatgattcgtctcatcactcacgggctcggtggagaaggctatctcaatttcatgggt
aatgagtttgggcatcctgaatggttggacttcccaaggaaaggaaataatgagagttac
cattatgccagaaggcagtttaatttaaccgacgatgaccttcttcgctataagttccta
aataactttgacagagatatgaatagactggaagaaagatgtggttggctttcagctcca
caggcctacgtgagtgaaaaacatgaagccaataagacaatcacctttgagagagcagga
cttctctttattttcaacttccacccaagcaagagctatacggactaccgagtcgggaca
gcaacaccagggaagttcaaaattgtactagattctgacgcagcggagtatggaggtcat
cagagactggaccacaacaccaactactttgctgaggcttttgaacataatgggcgcccc
tattctcttctggtgtacattccaagccgagtggctctcatccttcagaatgtggatctg
caaaactga

DBGET integrated database retrieval system