KEGG   Mus musculus (mouse): 74195Help
Entry
74195             CDS       T01002                                 

Gene name
Elp3, 2610507P14Rik, KAT9
Definition
elongator acetyltransferase complex subunit 3 (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 D1; 14
AA seq 566 aa AA seqDB search
MRQKRKGAKYVGQGRKGGSGFSEITGDLSPAELMMLTIGDVIKQLVEAHEQGKDVDLNKM
KTKTAAKYGLASQPRLVDIIAAVPPHYRKILIPKLKAKPVRTASGIAVVAVMCKPHRCPH
ISFTGNICIYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHS
VDKVEFIVMGGTFMALPEEYRDYFIRSLHDALSGHTSNNIHEAIKYSERSFTKCVGITIE
TRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAACESFHLAKDSGFKV
VTHMMPDLPNVGLERDIEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYS
PSDLIELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDV
RTREVGIQEIHHRVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETF
RFELGGGVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKMAVI
SGVGTRNYYRKIGYRLQGPYMVKMLK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaaagaggaaaggtgcaaaatacgtgggacaagggcgcaagggaggaagtgga
ttctctgagatcacaggggacctcagcccggctgagctgatgatgctgactataggagac
gttatcaagcagctggttgaagctcatgagcaggggaaagacgtcgatctaaataagatg
aaaaccaagacagctgccaagtatggccttgcgtcccagccccgcctggtggatatcatc
gctgcagtccctcctcactatcgaaagatcttgattcctaagctaaaggcgaagcccgtc
aggactgccagtgggatcgctgttgtggctgtgatgtgcaaaccccacagatgtccacac
atcagtttcacagggaatatatgtatatactgccccggaggacctgactccgattttgag
tattcaacccagtcttacacgggctatgagccaacttccatgagagctatccgtgctaga
tatgacccttttctgcagacaagacaccggatagagcagctaaagcagcttggtcacagt
gtggataaggtggagttcatcgtgatgggtggaacgttcatggcccttccagaagagtac
agagattatttcatccgaagtttacacgatgctttatcaggccatacttcaaacaatatt
cacgaggcaatcaagtattctgagagaagcttcacaaagtgtgttggaattacaattgag
accagacctgattattgcatgaagcggcacctaagtgacatgttgacttatggctgcaca
aggctggagatcggagtgcagagtgtctatgaagatgtggccagagataccaacaggggc
catactgtgaaggcagcgtgtgaatctttccacctggccaaagattctggtttcaaagtg
gtgacgcatatgatgcctgacctgccgaacgtgggactggagagagacattgagcagttt
atagaatttttcgagaaccctgcttttcgtcctgatggtttgaagctctacccaaccctg
gttatccgtggaactggtctgtatgagctgtggaaatcaggaaggtacaggagctattct
cccagtgacctgattgagctggtggctcggatcctagcccttgtgcccccgtggactcgt
gtgtaccgggtgcagagagacatcccaatgccccttgtcagctcaggagtggagcatggc
aacctgcgcgagctggcatttgcaagaatgaaggatcttggaatacagtgccgtgatgtg
agaaccagggaggttggaatccaagaaattcatcacagagtgcggccataccaggtcgag
ttggtacggagagattatgttgccaatggtggctgggaaactttcctgtcctacgaagat
cctgatcaggacattctgattggcctcctaaggctgcggaagtgctctgaggaaaccttc
cggtttgaactgggtggaggtgtttccatagtccgagagctacacgtgtatggaagtgtg
gtccctgtgagcagccgggatcccactaaatttcagcatcaggggttcggcatgctgctg
atggaagaggcagagagaatcgctcgggaagagcatggatctgggaaaatggcagttata
tcaggggtcggcacaagaaattattaccgaaagattggctacagattacaaggcccctac
atggtaaagatgctaaaataa

DBGET integrated database retrieval system