KEGG   Mus musculus (mouse): 74195Help
Entry
74195             CDS       T01002                                 

Gene name
Elp3, 2610507P14Rik, KAT9
Definition
(RefSeq) elongator acetyltransferase complex subunit 3
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     74195 (Elp3)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    74195 (Elp3)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    74195 (Elp3)
   HAT complexes
    Elongator complex
     74195 (Elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14; 14 D1
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAELMMLTIGDVIKQLVEAHEQGKDVDLNKMKTKTAAKYGLASQPRLVDI
IAAVPPHYRKILIPKLKAKPVRTASGIAVVAVMCKPHRCPHISFTGNICIYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRSLHDALSGHTSNNIHEAIKYSERSFTKCVGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAACESFHLAKDSGFKVVTHMMPDLPNVGLERDIEQ
FIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYSPSDLIELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHRVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKMAVISGVGTRNYYRKIGYRLQGP
YMVKMLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaaagaggaaaggggacctcagcccggctgagctgatgatgctgactatagga
gacgttatcaagcagctggttgaagctcatgagcaggggaaagacgtcgatctaaataag
atgaaaaccaagacagctgccaagtatggccttgcgtcccagccccgcctggtggatatc
atcgctgcagtccctcctcactatcgaaagatcttgattcctaagctaaaggcgaagccc
gtcaggactgccagtgggatcgctgttgtggctgtgatgtgcaaaccccacagatgtcca
cacatcagtttcacagggaatatatgtatatactgccccggaggacctgactccgatttt
gagtattcaacccagtcttacacgggctatgagccaacttccatgagagctatccgtgct
agatatgacccttttctgcagacaagacaccggatagagcagctaaagcagcttggtcac
agtgtggataaggtggagttcatcgtgatgggtggaacgttcatggcccttccagaagag
tacagagattatttcatccgaagtttacacgatgctttatcaggccatacttcaaacaat
attcacgaggcaatcaagtattctgagagaagcttcacaaagtgtgttggaattacaatt
gagaccagacctgattattgcatgaagcggcacctaagtgacatgttgacttatggctgc
acaaggctggagatcggagtgcagagtgtctatgaagatgtggccagagataccaacagg
ggccatactgtgaaggcagcgtgtgaatctttccacctggccaaagattctggtttcaaa
gtggtgacgcatatgatgcctgacctgccgaacgtgggactggagagagacattgagcag
tttatagaatttttcgagaaccctgcttttcgtcctgatggtttgaagctctacccaacc
ctggttatccgtggaactggtctgtatgagctgtggaaatcaggaaggtacaggagctat
tctcccagtgacctgattgagctggtggctcggatcctagcccttgtgcccccgtggact
cgtgtgtaccgggtgcagagagacatcccaatgccccttgtcagctcaggagtggagcat
ggcaacctgcgcgagctggcatttgcaagaatgaaggatcttggaatacagtgccgtgat
gtgagaaccagggaggttggaatccaagaaattcatcacagagtgcggccataccaggtc
gagttggtacggagagattatgttgccaatggtggctgggaaactttcctgtcctacgaa
gatcctgatcaggacattctgattggcctcctaaggctgcggaagtgctctgaggaaacc
ttccggtttgaactgggtggaggtgtttccatagtccgagagctacacgtgtatggaagt
gtggtccctgtgagcagccgggatcccactaaatttcagcatcaggggttcggcatgctg
ctgatggaagaggcagagagaatcgctcgggaagagcatggatctgggaaaatggcagtt
atatcaggggtcggcacaagaaattattaccgaaagattggctacagattacaaggcccc
tacatggtaaagatgctaaaataa

DBGET integrated database retrieval system