KEGG   Mus musculus (mouse): 74256Help
Entry
74256             CDS       T01002                                 

Gene name
Cyld, 2010013M14Rik, 2900009M21Rik, C130039D01Rik, CDMT, CYLD1, EAC, mKIAA0849
Definition
cylindromatosis (turban tumor syndrome) (EC:3.4.19.12)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    74256 (Cyld)
  Development
   04380 Osteoclast differentiation
    74256 (Cyld)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     74256 (Cyld)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C67
   74256 (Cyld)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 C3; 8
AA seq 955 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRV
PSTKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERLSLFRNRLRLS
KGLQVDVGSPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDNGLESDFAGPGDTMQVEPPPLEINSRVSLKV
GESTESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPALSDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKVTGSTSDPGSRNRSELFYTLNG
SSVDSQQSKSKNPWYIDEVAEDPAKSLTEMSSDFGHSSPPPQPPSMNSLSSENRFHSLPF
SLTKMPNTNGSMAHSPLSLSVQSVMGELNSTPVQESPPLPISSGNAHGLEVGSLAEVKEN
PPFYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRP
DSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSC
YLDSTLFCLFAFSSALDTVLLRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMK
LRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEK
NEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLL
EDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLP
KDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGF
NIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcctgtggagccaagagaaagttacttcaccctactgggaagaacggatt
ttttatctgcttcttcaagaatgcagtgtaacagacaaacaaactcagaagctgctgaaa
gtacccaaagggagtataggacagtacatccaagaccgttctgtggggcattcaagagtt
ccttccacaaaaggcaagaaaaatcagattggattaaaaatcttggagcaaccgcatgca
gttctgtttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagagttactg
ttggcaattaccaactgtgaggagaggctcagcctatttagaaacagactccgactaagt
aaaggcctccaggtagacgtgggcagtcctgtgaaagtacagctgcgatctggggaagag
aaatttccaggagttgtacgcttcagaggacctttattagcggagaggacggtgtcgggg
attttctttggagtagaattattggaagaaggtcgtggtcaaggtttcacggatggggta
tatcaagggaagcagcttttccagtgtgatgaggactgtggcgtgtttgttgcattggac
aaactagaacttatagaagatgatgacaatggattggaaagtgattttgcaggcccagga
gatacaatgcaggttgaacctccccctttggaaataaactccagagtttctttgaaggtt
ggagaaagtacagaatctggaacagtaatattctgtgatgttttaccaggaaaagagagt
ctaggatattttgttggtgtggacatggataaccctattggcaactgggatggaaggttt
gatggagtacagctctgtagttttgcaagtgttgaaagtacaattctcctgcacatcaat
gacatcatcccagctttatcagatagcgtgacacaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgtaggtgacaaaggttcatctagtcataataaaccaaaggttaca
ggatctacctcagaccctggaagtagaaacagatctgaattattttataccttaaatggg
tcatctgttgactcacaacaatccaagtccaaaaatccatggtacattgatgaagttgca
gaagaccctgcaaagtcacttacagagatgtcttcggacttcggacattcatctcctcca
ccgcagcctccttccatgaactccttgtctagcgagaacagattccactccttacccttc
agcctgacaaagatgcccaatactaatggcagcatggctcatagtccactctctctgtca
gtgcagtctgtgatgggggagctgaacagcacacctgtccaggagagtccacccttgccc
atctcttctgggaatgcacacgggctagaggtgggctcactggctgaagtaaaagagaac
cccccgttctatggggttatccgttggattggccagccaccagggctcagtgacgtgcta
gctggactggaactggaagatgaatgcgcaggctgtacagatggaactttcaggggcacg
cggtatttcacgtgtgccctgaagaaggcactgtttgtgaaactgaagagctgcagaccg
gactctaggtttgcatccttgcagcctgtttccaatcaaattgaaaggtgtaactcttta
gcatttgggggctatttaagtgaagtagtagaagaaaatactccacctaaaatggaaaag
gaaggtttagagataatgattggaaagaagaaaggcatccagggccattacaattcttgt
tacttagactcaactttattctgcttatttgcttttagttctgccctggacactgtgtta
cttagacccaaagagaagaatgatatagagtattacagtgagactcaggagctactgagg
acagagatagtcaatcctctgagaatatatggatatgtgtgtgccacaaagattatgaaa
ctgaggaaaatacttgaaaaagttgaggctgcatcaggttttacctctgaagaaaaagat
cctgaagaattcttaaatatcctgtttcatgatattttaagggttgaaccattgttaaaa
ataagatcagcaggtcaaaaagttcaagactgtaacttctatcaaatttttatggaaaaa
aatgagaaagttggagtacccacaattcagcagttattagaatggtcttttatcaacagc
aacctgaaatttgcagaggcaccatcatgcttgattatccagatgcctcggtttggaaaa
gactttaaactatttaaaaaaatttttccttccctggaattaaatataacagatttactt
gaagacactcccaggcagtgccgcatctgtggaggacttgcgatgtacgagtgcagggag
tgctatgacgatccggacatctcagctgggaagatcaagcagttctgtaagacctgcagc
actcaggttcaccttcatcccaggaggttgaatcattcttatcatccagtatcacttccc
aaagacttgcctgactgggactggagacacggctgcatcccctgtcagaagatggagtta
tttgctgttctctgcatagaaacgagccactatgttgcttttgtgaagtatgggaaggat
gactctgcctggcttttctttgacagcatggcggatcgagatggtggtcagaatggcttc
aacattccacaagtgacgccctgcccagaagtgggagagtacttgaagatgtctctggag
gacctgcactctttggattccagaaggattcaaggctgtgcgcgcagacttctttgcgat
gcatacatgtgcatgtaccagagtccaaccatgagcctgtacaaataa

DBGET integrated database retrieval system