KEGG   Mus musculus (mouse): 74270Help
Entry
74270             CDS       T01002                                 

Gene name
Usp20, 1700055M05Rik, AI467231, Vdu2
Definition
ubiquitin specific peptidase 20 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     74270 (Usp20)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   74270 (Usp20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 B; 2
AA seq 916 aa AA seqDB search
MGDARDLCPHLDCIGEVTKEDLLLKSKGTCQSCGVAGPNLWACLQVTCPYVGCGESFADH
SSIHAQVKKHNLTVNLTTFRVWCYACEREVFLEQRLAVHLASSSARLSEQDSPPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLISEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPMVAAVAALTDARDSDSSDTDERRDGDRSPSEDEFLSCDSSSDRGEGDGQG
RGGGSSKAEMELLISDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMASLDE
QSREAQPPSPRSTSPCQTPEPDNEAHIRSSSRPCSPVHHHHEGHSKLSSSPPRASPVRMG
PSYVLKKAQVPSTGGRRRKEQSYRSVISDVFNGSVLSLVQCLTCDRVSTTVETFQDLSLP
IPGKEDLAKLHSAIYQNVPAKPGACGDSYSSQGWLAFIVEYIRRFVVSCTPSWFWGPVVT
LEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLCLPEILCVHLKRFRHEVMYSFK
VSSHVSFPLEGLDLRPFLAKECTSQVTTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYE
FDDQYVTEVHETVVQNVEAYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLN
KFNTFAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQSVWEHLYSRFGGGPAVNHLY
VCSICQVEIEALAKRRRVEIDTFIKLNKAFQAEESPAVIYCISMHWFREWEAFVKGKDSE
PPGPIDNSRIAQVKGSGHIQLKQGADCGQISEETWTYLSSLYGGGPEIAIRQSVAQLPDP
ESLHGEQKIEAETRAL
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgccagagacctctgccctcacctggactgcataggggaggtgaccaaagag
gatttgctgcttaaatctaagggaacctgccagtcatgtggggttgctggacctaaccta
tgggcttgcctccaggtcacctgcccttacgttggctgtggagagtcttttgctgaccat
agcagcattcatgcccaggtgaaaaagcacaacctgactgtgaacctgaccacgttccgg
gtctggtgctacgcctgtgagcgtgaagtctttctggagcagcgtctggcagtccacctg
gccagctcctcagccaggctctcagagcaggactccccaccaccctcccacccgctgaaa
gctgtccctattgctgtggctgatgaaggagagtctgagtctgaggatgacgacctgaag
cctcgaggcctcacaggcatgaagaacctgggaaactcctgttacatgaatgctgccctg
caggccttgtccaattgccccccgctcacccagttcttcctggagtgtggtggtctggtg
cgcacagacaagaagccagccttgtgcaaaagttaccagaagttgatctctgaggtgtgg
cacaagaagcggccaagctatgtggtccccaccagcctgtcccatgggatcaagttggtc
aacccgatgttccgaggctatgcccagcaggacacccaggagttcctacgctgcctaatg
gaccagcttcatgaggagctcaaggagcccatggtcgctgctgtggcagcactcaccgat
gctcgggactccgattccagtgacacagatgagaggcgtgatggcgaccggagcccatca
gaggacgagtttctgtcctgtgactcgagcagtgacaggggtgagggtgatgggcagggg
cgtggtggaggcagctcaaaggccgagatggagctgctgatctcagatgaggcgggccga
gccatctctgagaaggagcggatgaaggaccgcaagttctcctggggccagcagcgcacc
aactcagagcaagtggatgaggatgcagatgtggacacggccatggcgtcccttgatgag
caatccagagaggcccagccaccatcaccaaggtccaccagcccctgccagaccccagaa
ccagacaacgaagcccacatacgcagctcctctcgtccctgcagccctgttcaccaccac
cacgagggccattccaagctgtccagcagccctcctcgtgcaagccctgtgaggatgggg
ccgtcgtatgtgctcaagaaagcccaggtgccaagcactggtggtcggaggcggaaggag
cagagctaccgcagtgtcatctcagacgtcttcaatggctctgtcctcagcctggtgcag
tgtcttacctgtgaccgggtgtctaccacagtggagacattccaggacctgtcattgccc
atccctggcaaggaagatctagccaaactccactctgccatctaccagaatgtaccagcc
aagccgggtgcctgtggggacagctattcctcccagggctggctggccttcatcgtggag
tacatcagacggtttgtggtatcctgtacccccagctggttttggggacctgttgtcaca
ctagaagactgccttgctgctttctttgctgctgatgagctgaagggtgacaacatgtac
agctgtgagcggtgtaagaagcttcggaatggcgtgaagtactgtaaagtcctatgtctg
cctgagattctgtgcgtccacctgaagcgcttccggcatgaggtgatgtactccttcaag
gtcagcagccatgtctctttccccctcgagggactggacctacgcccttttctggccaag
gagtgcacgtcccaggtcaccacctatgacctcctctctgtcatctgtcaccatggcaca
gcaggcagtgggcactacattgcctactgtcagaacgtgatcaatgggcagtggtacgaa
ttcgatgaccagtacgtcaccgaggtccatgagacggtagtacagaacgtggaggcctac
gtgctgttctacaggaagagcagtgaggaggccatgcgtgagcggcagcaggtagtgtcc
ctggctgccatgcgggaacccagcctgctccgcttctacgtgtcccgagaatggctcaac
aaattcaacacctttgccgagccagggcccatcaccaaccacaccttcctgtgctcccat
ggaggtatcccacccaacaaataccactacatcgatgacctggtggtcatcctgccgcag
agcgtctgggagcacctgtacagcaggtttgggggcggccctgctgtgaaccatctgtat
gtgtgctccatctgccaggtggagattgaggccctggccaagcgcaggagggtggagatt
gacactttcatcaagctgaacaaggcattccaagctgaggagtctcccgcggtcatctac
tgtatcagcatgcactggttccgagagtgggaggccttcgtcaaggggaaggacagtgag
cctcccgggcccatcgacaacagcaggattgcccaggtcaaaggcagtggccatatccag
ctaaagcagggggctgactgtggccagatttcggaggagacctggacctatctgagcagt
ctgtatgggggcggccctgagattgccatccggcagagtgtggcccagctcccagaccca
gaaagcttgcacggagagcagaagattgaggctgagacccgggctctgtga

DBGET integrated database retrieval system