KEGG   Mus musculus (mouse): 74370Help
Entry
74370             CDS       T01002                                 

Gene name
Rptor, 4932417H02Rik, Rap, Raptor, mKIAA1303
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
mmu  Mus musculus (mouse)
Pathway
Autophagy - other
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    74370 (Rptor)
   04152 AMPK signaling pathway
    74370 (Rptor)
   04150 mTOR signaling pathway
    74370 (Rptor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    74370 (Rptor)
   04136 Autophagy - other eukaryotes
    74370 (Rptor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    74370 (Rptor)
  Aging
   04211 Longevity regulating pathway - mammal
    74370 (Rptor)
   04213 Longevity regulating pathway - multiple species
    74370 (Rptor)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    74370 (Rptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
Position
11; 11 E2
AA seq 914 aa AA seqDB search
MGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQ
SSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAV
IVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAH
EKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVRK
ELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSVS
SYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILSF
ETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKA
TVNARPQRILDTSSLTQSAPASPTNKGMHMHQVGGSPPASSTSSCSLTNDVAKQTVSRDL
PSSRPGTAGPTGAQYTPHSHQFPRTRKMFDKGPDQTTDDADDAAGHKSFICASMQTGFCD
WSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLNR
NPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDC
SLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSS
GDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSE
CRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALDI
HPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSN
DYYISVYSVEKRVR
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggaaaacaggagccccccagagcagctgcccatcgtcctgcaggtgctgcta
agccaggtgcaccggctgagagcattggacttgctgggacggtttttggacttgggccct
tgggcggtgagcttggccctgtcggtgggcatcttcccctatgtactgaagctgcttcag
agctcagcccgagagcttcggccactccttgtcttcatctgggccaaaatcctcgctgtc
gacagttcgtgccaagctgacctcgtgaaggacaacggtcacaagtacttcctatccgtc
ttggcagacccatacatgccagctgaacataggaccatgacagccttcattcttgctgta
atcgtcaacagctacacaacagggcaagaggcctgcctccagggaaacctgattgccatc
tgtctggagcagctcagcgacccacaccccttgctacgccagtgggtggccatttgcctg
ggaaggatctggcagaacttcgactctgcaagatggtgtggggtgagagacagtgcccac
gaaaagctctatagcctcctctctgaccccatccctgaggtccgatgtgcagctgtattt
gccctgggcacctttgtgggaaattctgctgagaggacagaccactctaccaccattgac
cacaatgtggccatgatgctggctcagctgatcaatgatggaagccccatggtccggaag
gagctggtggtggctctgagtcaccttgtagtccaatatgaaagcaatttctgcactgtg
gccctgcagttcatggaggaagaaaagaactaccctttgccttctccagcagccacagag
ggagggagcttgaccccagttcgagacagcccatgcacccccagactccgttcagtgagc
tcctatgggaacatccgagccgtcacgacagctaggaacctgaacaaatctttgcagaat
ctgagcttgacggaagaatcgggcagctcagtggccttctctcccgggaacctcagcacc
agcagcagtgccagcagcaccttggggagccctgagaacgaggagtacatcctgtccttc
gagaccatcgacaagatgcggcgtgtgagctcctactcagcgctcaactccctcatagga
gtttcttttaatagtgtttacactcaaatttggagagtcttactgcatctggctgctgat
ccctatccagatgtttctgatttagccatgaaagtcctcaacagcattgcttacaaggcc
acagtgaacgcccggccccaacgaatccttgacacatcctctctcacacagtcggcccca
gccagcccaaccaacaagggcatgcacatgcaccaggtgggaggctccccgccagcatct
agcaccagcagctgcagcctgaccaatgatgtggccaagcagactgtcagccgtgacctg
ccttccagccgcccgggtactgccggccccacaggggcacagtacacccctcactcccac
cagttccctcgaacacgaaagatgtttgacaaaggccctgatcagaccacagatgatgca
gatgatgctgccggacacaagagcttcatttgtgcctctatgcagacagggttctgtgac
tggagtgcccgctactttgcccagccagtcatgaagatccccgaggagcatgacctagag
agtcagatccgcaaggagcgtgagtggcggttcctgaggaacactcgagtcaggaagcag
gctcagcaggtcatccagaagggcatcaccagactggacgatcagatctttctgaacagg
aaccccggcgttccttctgtggtcaaattccatccctttacaccatgcatagctgtcgcc
gacaaggacagcatctgtttttgggactgggagaaaggagagaagctggactatttccac
aatggcaaccctcggtacaccagggtcaccgccatggagtacctgaatggtcaggactgt
tccttgctgctgacagccacagatgatggtgccatcagggtctggaagaattttgctgat
ttggaaaagaatccagagatggtgactgcgtggcaagggctctcagacatgcttccaaca
acacgaggagctgggatggtggtagactgggaacaagaaactggccttctcatgagctca
ggggacgtgcgcattgtcaggatctgggatactgaccgggagacgaaggtgcaggacatc
cccacgggtgctgacagctgtgtgacaagtctgtcttgtgattcgcaccgttcgctcatt
gtggctggcctgggtgatggctcgatccgtgtctacgacaggaggatggcactcagtgaa
tgccgggtcatgacttaccgagagcacacagcgtgggtggtaaaggcctacctgcagaag
caccctgagggccacatcgtgagtgtgagtgtcaatggagatgtgcgcttcttcgaccct
cggatgcccgagtctgtgaatgtaatgcagattgtgaaggggctgacagccctggacatc
cacccccaggcaaacctgatcgcctgtggctccatgaaccagttcacagccatctacaac
ggaaatggagagctgatcaacaacatcaaatactatgatggcttcatgggccagcgagtc
ggggccatcagctgcctggctttccacccacactggcctcatctggccgtaggaagcaat
gactactacatttccgtgtattcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system