KEGG   Mus musculus (mouse): 74370Help
Entry
74370             CDS       T01002                                 

Gene name
Rptor, 4932417H02Rik, Rap, Raptor, mKIAA1303
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
mmu  Mus musculus (mouse)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:mmu04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mmu04910]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mmu05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E2; 11
AA seq 1335 aa AA seqDB search
MESEMLQSPLMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILDTSSLTQSAPASPTNKGMHMHQVGGSPPASSTSSCSLTNDVAKQTVSRD
LPSSRPGTAGPTGAQYTPHSHQFPRTRKMFDKGPDQTTDDADDAAGHKSFICASMQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALD
IHPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggagatgctgcagtcgcctcttatgggactcggggaggaagatgaggcggac
cttacagattggaacttgcctttggcttttatgaagaaaagacattgtgagaaaatcgaa
ggctccaaatctttagcgcagagctggagaatgaaggatcggatgaagacggtgagtgtg
gccttggtcctgtgcctgaatgtgggtgtggatcctccggatgtggtgaagaccacaccc
tgtgctcggctggaatgctggatcgatcctctgtctatgggccctcagaaagctctggaa
accatcggtgcaaacctacagaagcagtatgagaactggcagccaagggctcggtacaag
cagagcctcgaccctactgtggatgaagtcaagaaactttgcacatctctgcgccggaac
gccaaggaggaacgggtccttttccactacaatggccacggggtgcccaggcctacagtg
aatggagaggtctgggtcttcaacaagaactacactcagtacatccctctgtccatatac
gacctgcagacgtggatgggcagcccatccatctttgtctacgactgttccaatgctggc
ctcatcgtcaagtccttcaaacagtttgcactgcagagggagcaggaactagaggtagct
gcgattaacccaaaccatccacttgcccagatgcccttgcctccctcaatgaaaaactgc
atccagttggcagcgtgtgaggcacacgagctgctgcccatgatccctgacctcccagcc
gacctgttcacatcctgcctcaccactcccatcaagattgctctgcgctggttttgcatg
cagaagtgcgtgagtctggtgcctggagtcacactggatttgatagaaaagatccctggc
cggctgaatgaccggaggacccctctgggagagctgaactggatcttcacagccatcaca
gataccatcgcctggaatgtgctccctcgggatctcttccaaaagcttttccgacaggac
ctgctcgtggcaagtttgtttagaaattttttattggcagaaagaatcatgaggtcatat
aactgcaccccagtaagcagcccgcggctccccccgacatacatgcatgccatgtggcag
gcctgggaccttgctgtggacatttgcctctctcagctgccaaccatcatcgaagagggt
actgccttcaggcacagcccattctttgccgagcagctgacagcattccaggtgtggctc
acaatgggtgtggaaaacaggagccccccagagcagctgcccatcgtcctgcaggtgctg
ctaagccaggtgcaccggctgagagcattggacttgctgggacggtttttggacttgggc
ccttgggcggtgagcttggccctgtcggtgggcatcttcccctatgtactgaagctgctt
cagagctcagcccgagagcttcggccactccttgtcttcatctgggccaaaatcctcgct
gtcgacagttcgtgccaagctgacctcgtgaaggacaacggtcacaagtacttcctatcc
gtcttggcagacccatacatgccagctgaacataggaccatgacagccttcattcttgct
gtaatcgtcaacagctacacaacagggcaagaggcctgcctccagggaaacctgattgcc
atctgtctggagcagctcagcgacccacaccccttgctacgccagtgggtggccatttgc
ctgggaaggatctggcagaacttcgactctgcaagatggtgtggggtgagagacagtgcc
cacgaaaagctctatagcctcctctctgaccccatccctgaggtccgatgtgcagctgta
tttgccctgggcacctttgtgggaaattctgctgagaggacagaccactctaccaccatt
gaccacaatgtggccatgatgctggctcagctgatcaatgatggaagccccatggtccgg
aaggagctggtggtggctctgagtcaccttgtagtccaatatgaaagcaatttctgcact
gtggccctgcagttcatggaggaagaaaagaactaccctttgccttctccagcagccaca
gagggagggagcttgaccccagttcgagacagcccatgcacccccagactccgttcagtg
agctcctatgggaacatccgagccgtcacgacagctaggaacctgaacaaatctttgcag
aatctgagcttgacggaagaatcgggcagctcagtggccttctctcccgggaacctcagc
accagcagcagtgccagcagcaccttggggagccctgagaacgaggagtacatcctgtcc
ttcgagaccatcgacaagatgcggcgtgtgagctcctactcagcgctcaactccctcata
ggagtttcttttaatagtgtttacactcaaatttggagagtcttactgcatctggctgct
gatccctatccagatgtttctgatttagccatgaaagtcctcaacagcattgcttacaag
gccacagtgaacgcccggccccaacgaatccttgacacatcctctctcacacagtcggcc
ccagccagcccaaccaacaagggcatgcacatgcaccaggtgggaggctccccgccagca
tctagcaccagcagctgcagcctgaccaatgatgtggccaagcagactgtcagccgtgac
ctgccttccagccgcccgggtactgccggccccacaggggcacagtacacccctcactcc
caccagttccctcgaacacgaaagatgtttgacaaaggccctgatcagaccacagatgat
gcagatgatgctgccggacacaagagcttcatttgtgcctctatgcagacagggttctgt
gactggagtgcccgctactttgcccagccagtcatgaagatccccgaggagcatgaccta
gagagtcagatccgcaaggagcgtgagtggcggttcctgaggaacactcgagtcaggaag
caggctcagcaggtcatccagaagggcatcaccagactggacgatcagatctttctgaac
aggaaccccggcgttccttctgtggtcaaattccatccctttacaccatgcatagctgtc
gccgacaaggacagcatctgtttttgggactgggagaaaggagagaagctggactatttc
cacaatggcaaccctcggtacaccagggtcaccgccatggagtacctgaatggtcaggac
tgttccttgctgctgacagccacagatgatggtgccatcagggtctggaagaattttgct
gatttggaaaagaatccagagatggtgactgcgtggcaagggctctcagacatgcttcca
acaacacgaggagctgggatggtggtagactgggaacaagaaactggccttctcatgagc
tcaggggacgtgcgcattgtcaggatctgggatactgaccgggagacgaaggtgcaggac
atccccacgggtgctgacagctgtgtgacaagtctgtcttgtgattcgcaccgttcgctc
attgtggctggcctgggtgatggctcgatccgtgtctacgacaggaggatggcactcagt
gaatgccgggtcatgacttaccgagagcacacagcgtgggtggtaaaggcctacctgcag
aagcaccctgagggccacatcgtgagtgtgagtgtcaatggagatgtgcgcttcttcgac
cctcggatgcccgagtctgtgaatgtaatgcagattgtgaaggggctgacagccctggac
atccacccccaggcaaacctgatcgcctgtggctccatgaaccagttcacagccatctac
aacggaaatggagagctgatcaacaacatcaaatactatgatggcttcatgggccagcga
gtcggggccatcagctgcctggctttccacccacactggcctcatctggccgtaggaagc
aatgactactacatttccgtgtattcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system