KEGG   Mus musculus (mouse): 74370Help
Entry
74370             CDS       T01002                                 

Gene name
Rptor, 4932417H02Rik, Rap, Raptor, mKIAA1303
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
mmu  Mus musculus (mouse)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    74370 (Rptor)
   04152 AMPK signaling pathway
    74370 (Rptor)
   04150 mTOR signaling pathway
    74370 (Rptor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    74370 (Rptor)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    74370 (Rptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 E2
AA seq 914 aa AA seqDB search
MGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQ
SSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAV
IVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAH
EKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVRK
ELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSVS
SYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILSF
ETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKA
TVNARPQRILDTSSLTQSAPASPTNKGMHMHQVGGSPPASSTSSCSLTNDVAKQTVSRDL
PSSRPGTAGPTGAQYTPHSHQFPRTRKMFDKGPDQTTDDADDAAGHKSFICASMQTGFCD
WSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLNR
NPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDC
SLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSS
GDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSE
CRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALDI
HPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSN
DYYISVYSVEKRVR
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggaaaacaggagccccccagagcagctgcccatcgtcctgcaggtgctgcta
agccaggtgcaccggctgagagcattggacttgctgggacggtttttggacttgggccct
tgggcggtgagcttggccctgtcggtgggcatcttcccctatgtactgaagctgcttcag
agctcagcccgagagcttcggccactccttgtcttcatctgggccaaaatcctcgctgtc
gacagttcgtgccaagctgacctcgtgaaggacaacggtcacaagtacttcctatccgtc
ttggcagacccatacatgccagctgaacataggaccatgacagccttcattcttgctgta
atcgtcaacagctacacaacagggcaagaggcctgcctccagggaaacctgattgccatc
tgtctggagcagctcagcgacccacaccccttgctacgccagtgggtggccatttgcctg
ggaaggatctggcagaacttcgactctgcaagatggtgtggggtgagagacagtgcccac
gaaaagctctatagcctcctctctgaccccatccctgaggtccgatgtgcagctgtattt
gccctgggcacctttgtgggaaattctgctgagaggacagaccactctaccaccattgac
cacaatgtggccatgatgctggctcagctgatcaatgatggaagccccatggtccggaag
gagctggtggtggctctgagtcaccttgtagtccaatatgaaagcaatttctgcactgtg
gccctgcagttcatggaggaagaaaagaactaccctttgccttctccagcagccacagag
ggagggagcttgaccccagttcgagacagcccatgcacccccagactccgttcagtgagc
tcctatgggaacatccgagccgtcacgacagctaggaacctgaacaaatctttgcagaat
ctgagcttgacggaagaatcgggcagctcagtggccttctctcccgggaacctcagcacc
agcagcagtgccagcagcaccttggggagccctgagaacgaggagtacatcctgtccttc
gagaccatcgacaagatgcggcgtgtgagctcctactcagcgctcaactccctcatagga
gtttcttttaatagtgtttacactcaaatttggagagtcttactgcatctggctgctgat
ccctatccagatgtttctgatttagccatgaaagtcctcaacagcattgcttacaaggcc
acagtgaacgcccggccccaacgaatccttgacacatcctctctcacacagtcggcccca
gccagcccaaccaacaagggcatgcacatgcaccaggtgggaggctccccgccagcatct
agcaccagcagctgcagcctgaccaatgatgtggccaagcagactgtcagccgtgacctg
ccttccagccgcccgggtactgccggccccacaggggcacagtacacccctcactcccac
cagttccctcgaacacgaaagatgtttgacaaaggccctgatcagaccacagatgatgca
gatgatgctgccggacacaagagcttcatttgtgcctctatgcagacagggttctgtgac
tggagtgcccgctactttgcccagccagtcatgaagatccccgaggagcatgacctagag
agtcagatccgcaaggagcgtgagtggcggttcctgaggaacactcgagtcaggaagcag
gctcagcaggtcatccagaagggcatcaccagactggacgatcagatctttctgaacagg
aaccccggcgttccttctgtggtcaaattccatccctttacaccatgcatagctgtcgcc
gacaaggacagcatctgtttttgggactgggagaaaggagagaagctggactatttccac
aatggcaaccctcggtacaccagggtcaccgccatggagtacctgaatggtcaggactgt
tccttgctgctgacagccacagatgatggtgccatcagggtctggaagaattttgctgat
ttggaaaagaatccagagatggtgactgcgtggcaagggctctcagacatgcttccaaca
acacgaggagctgggatggtggtagactgggaacaagaaactggccttctcatgagctca
ggggacgtgcgcattgtcaggatctgggatactgaccgggagacgaaggtgcaggacatc
cccacgggtgctgacagctgtgtgacaagtctgtcttgtgattcgcaccgttcgctcatt
gtggctggcctgggtgatggctcgatccgtgtctacgacaggaggatggcactcagtgaa
tgccgggtcatgacttaccgagagcacacagcgtgggtggtaaaggcctacctgcagaag
caccctgagggccacatcgtgagtgtgagtgtcaatggagatgtgcgcttcttcgaccct
cggatgcccgagtctgtgaatgtaatgcagattgtgaaggggctgacagccctggacatc
cacccccaggcaaacctgatcgcctgtggctccatgaaccagttcacagccatctacaac
ggaaatggagagctgatcaacaacatcaaatactatgatggcttcatgggccagcgagtc
ggggccatcagctgcctggctttccacccacactggcctcatctggccgtaggaagcaat
gactactacatttccgtgtattcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system