KEGG   Mus musculus (mouse): 74434Help
Entry
74434             CDS       T01002                                 

Gene name
Sohlh2, 4933406N12Rik, AI413378, Sosf2
Definition
(RefSeq) spermatogenesis and oogenesis specific basic helix-loop-helix 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Histidinol_dh GATase_2
Motif
Other DBs
NCBI-GeneID: 74434
NCBI-ProteinID: NP_083213
MGI: 1921684
Ensembl: ENSMUSG00000027794
Vega: OTTMUSG00000023038
UniProt: Q9D489
Position
3; 3 C
AA seq 467 aa AA seqDB search
MADRISTGELGRRPGQGRVNLLLVGDATRYFLAGSMQKFFPSTAQITLTISNVKKVAVLL
AANSFDIIFLKVTSTLTAEEQEAAKLIRSGKKKNTHLLFAFVIPERLKGYVSEYGADISF
SEPLTLEKVNTVIHYWKTYFTNTDMENTELPPECRLYFQTSRSELGGRFSTDMFLCSELL
KNDARLGLKAPLSSLDKSKQASFLHSTKEKLRRERIKSCCEQLRTLLPYVKGRKSDVASV
IEATVDYVKQVRESLSPAIMAQVTEAIQNNRRFSKRQMPIELFLPFSATSQREDAMLTSA
FSPVQEIQLLADRGLNVYSMTAAGGALEGAVRGQPGSVSESSIEDLYKTRVPSTARSLNS
FHSVKYTSGTVSPHEAAARTNQNISTYLPPTAPSVSNFIPQHCNAMLCPARPTSPNCLCT
PGHELAASSRAASASIFRGFRAASASDHQASQPPALPSPQPHDSSYF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccggatcagcactggggagctaggccggaggcctgggcagggcagagtaaat
cttttgctggttggagatgccacaagatacttcctggctggctctatgcagaaattcttt
cctagcacagcacagatcaccctgaccatcagcaatgtgaagaaggtcgccgtgcttttg
gctgctaactcgtttgacataattttcttgaaggtgacttccactctaactgcagaggag
caggaggctgccaagttaattagatctggcaagaagaaaaacacacatttgctgtttgct
tttgtaatacctgaaagacttaaaggctatgtttcagaatatggagctgacattagtttc
agtgagccgctgaccttggaaaaagtgaacacggtgatacactactggaaaacgtatttc
acaaatacggatatggaaaacactgagttgcctccagaatgccggctgtactttcagacg
tcccgcagtgaactcggagggcgtttttctacagatatgtttctttgctctgaactgctg
aagaatgacgctagacttggattaaaggccccgttgtcgagtctagacaaaagcaaacag
gcgtcttttcttcactcaaccaaagaaaagctgagacgagaacgcatcaagtcttgctgt
gagcagctgcgcacgctcctgccatacgtcaaggggaggaagagcgatgtggcatcagtt
atcgaggccacagttgattatgtgaagcaggtccgggagtctctctctccagccattatg
gcccaggttacagaagccattcagaacaatagaaggttttctaagagacagatgcccatc
gagctgttccttccattctcagccacatcacagagggaagatgccatgctgaccagcgct
ttctcacctgtgcaagagattcagctcctggctgatcggggcctgaacgtgtattccatg
actgctgcaggaggagctttggagggagcagtgagaggtcagccaggctctgtttccgag
agctctattgaggatctgtataagactcgcgtccccagcacagcccgatctctgaattcc
ttccactctgtcaaatacacttctggaactgtctctccccatgaggcagctgccaggaca
aatcagaacatttccacttatttgccacccactgcacccagtgtgtccaactttattcct
cagcactgcaatgccatgctttgcccagcacgcccaaccagtcccaactgcctgtgcact
ccgggccatgagcttgcagccagttctcgcgctgcctcagccagcatctttcgtggattc
cgtgcggcgtcagcttcggatcaccaggcctctcagccacctgctctgccatctccacag
cctcacgacagtagttacttttaa

DBGET integrated database retrieval system