KEGG   Mus musculus (mouse): 74646Help
Entry
74646             CDS       T01002                                 

Gene name
Spsb1, 1110014L01Rik, 4930422J18Rik, AI596360, AI854583, SSB-1, SSB1
Definition
(RefSeq) splA/ryanodine receptor domain and SOCS box containing 1
  KO
K10343  
SPRY domain-containing SOCS box protein 1/4
Organism
mmu  Mus musculus (mouse)
Brite
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     74646 (Spsb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 E2
AA seq 273 aa AA seqDB search
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRSVRLALGKERLGAIPALPLPASLKAYLLYQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaaggtcacaggagggatcaagactgtggacatgcgggaccccacataccga
cctctgaagcaggaactccaggggctggattactgcaagcccacccggctggacctgctg
ctcgacatgccccctgtgtcctacgatgtgcagctgctccactcctggaacaataacgac
cgttcgctcaacgtcttcgtgaaggaagatgacaagttgatctttcaccggcatccggtg
gcccagagcacggacgccatcaggggcaaagttgggtacacacgtggactgcatgtatgg
cagatcacatgggccatgaggcaacgaggcacgcatgccgtggtgggggtggccacagca
gatgcccctttgcactccgttgggtacacaacccttgtaggaaataaccatgaatcctgg
ggctgggacctggggcgtaaccgtctctaccacgacggcaagaaccagccaagtaaaaca
tacccagcctttctggagccggacgagacattcattgtccctgactcctttctcgtggcc
ctggacatggatgatgggaccttaagtttcatcgtggatggacagtacatgggagtggct
ttccggggactcaagggtaaaaagctgtatcctgtagtgagtgccgtctggggccactgt
gagatccgcatgcgctacttgaacggacttgatcctgagcccctgccactcatggacctg
tgccggcgttcggtgcgcctagcgctgggaaaggagcgcctgggtgccatccccgctctg
ccgctacctgcctccctcaaagcctacctcctctaccagtga

DBGET integrated database retrieval system