KEGG   Mus musculus (mouse): 74841Help
Entry
74841             CDS       T01002                                 

Gene name
Usp38, 4631402N15Rik, 4833420O05Rik, AA536967, AU044701, AW544820, mKIAA1891
Definition
ubiquitin specific peptidase 38 (EC:3.4.19.12)
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     74841 (Usp38)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   74841 (Usp38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 C3; 8 38.68 cM
AA seq 1042 aa AA seqDB search
MDKILEGLVSSSHPLPLKRMIVRKVVEFAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLQQGYHSVDRKDVAILDYIHNGLKLIMSCPSV
LDLFSLLQVEVLRMVCERPEPVLCARLSDLLTDFVQCVPKGKLSVTFCQQLVRTIGHFQC
VSTQEKELREYVSQVTKVSTLLQNIWKAEPSTLLPSLQEVFASISSTDASFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHVIVPHIVNLVH
SFRSDGLPSSTAFLVQLTELVHCMMYHYSGFPDLYEPILEAVKDFPKPSEEKIKLILNQS
AWTSQSNALASCLSRLSGKSETGKTGLINLGNTCYMNSVLQALFMATEFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEE
KILRVQSSHKPSEGLDCAETCLQEVTSKVAVPTESPGTGDSEKTLIEKMFGGKLRTHICC
LNCGSTSHKVEAFTDLSLAFCPSPSVEDLSFQDTASLPSAQDDGLMQTSVADPEEEPVVY
NPATAAFVCDSVVNQRVLGSPPVEFHCAESSSVPEESAKILISKDVPQNPGGESTTSVTD
LLNYFLAPEVLTGENQYYCESCASLQNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKI
LDNVSLPLVLELPVKRTASFSSLSQSWSVDVDFTDINENLPKKLKPSGTEEAFCPKLVPY
LLSSVVVHSGVSSESGHYYSYARNITGTESSYQMCPQSESLALAPSQSCLLGVESPNTVI
EQDLENKEMSQEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQSRANGIDSDNP
ASGVWANGDPPLQKELMDAITKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPP
GSCGPTGGGGGGGFNTVGRLVF
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atggacaagattctggaaggcctggtgagctcctcgcacccgctgcccctcaagcggatg
attgtgcggaaggtggtggagttcgcggagcattggctcgacgaggcgcagtgcgaggcc
atgtttgacctgacgacccgcctcatcctggagggccaggaccctttccagcgacaagtg
ggccaccaggtgctggaggcctacgcgcggtaccaccggccggagttcgagtccttcttc
aacaagactttcgtgttgggcctccttcagcagggctaccactcagtggacaggaaggac
gtcgccatcctggactacattcacaacggcctgaagctgattatgagctgcccgtcggtg
ctggatctcttcagcctgctccaggtggaggtcctgcgaatggtttgcgagaggccggag
ccagtgctctgtgcccggctgagcgacctcctgaccgatttcgtgcagtgcgtccccaaa
gggaaactgtcagttaccttctgtcaacagctggttcgaacgataggtcatttccagtgc
gtgtccactcaggagaaggaactacgggagtatgtctcccaggtaacgaaagtgagtacc
ttactacagaatatttggaaggctgagccctccacgctgctaccttctctgcaagaagtt
tttgcaagcatctcttccacagatgcatcctttgagccctcggttgccttggcaagcctg
gtgcagcatattcctctgcagatgatcacagtcctcatcaggagcctaaccaccgaccca
aatgtaaaagatgcgagtatgacccaagctctctgcagaatgattgactggctgtcctgg
ccattggctcagcatgtagatacgtgggtaattgctctcctgaaaggactggcagctgtt
cagaagtttactattttgatagatgttactttgctgaaaatagaactggtttttaaccga
ctttggtttcctctcgtgagacctggtgctcttgcagtcctctctcatatgctgcttagt
tttcagcattctcctgaggcattccatgtgattgtccctcatatagttaacttggttcac
tccttcagaagtgatggcctaccttccagcacagccttcctagtacagttaacagagttg
gttcactgtatgatgtaccattactccggattcccagatctctatgagcctattctggag
gcagtaaaggactttcctaagcccagtgaagaaaagattaagctgattctcaatcaaagc
gcctggacttctcaatccaatgctttggcatcttgcttgtctagactttctggaaaatct
gaaactggaaaaactggtcttattaacctgggaaacacgtgttacatgaacagtgtttta
caagcattgtttatggctacagagttcagaagacaagtattatctttaaatctaaatggg
tgtaattcgttaatgaaaaaattacaacatctttttgcttttttggctcatacacaaagg
gaagcttacgcacctcggatattttttgaggcttccagacctccgtggtttactcccagg
tcacaacaggactgctctgagtacctcaggtttctgctggacagactccatgaagaagaa
aagatcttgcgagttcagtcctcacataagccttcggaaggtctggactgtgctgaaact
tgtttacaagaggtgaccagtaaggtagcagtgcccacagagtctcctggtacaggtgac
agtgagaagactctaatagagaaaatgtttggagggaagctacggactcacatctgctgc
ctaaactgtgggagtacctcacacaaagttgaagccttcacagatctttcgctagccttt
tgtcctagcccttctgtggaagacctgtctttccaagatacagcttcgttacccagtgct
caagatgatgggctaatgcaaaccagtgtcgctgacccagaagaagagccagtagtttat
aatccagcaacagctgcctttgtctgcgactcagttgtgaatcaaagagtattaggcagt
cctcctgttgagtttcactgtgctgaaagctcttctgtccctgaagaatctgcaaagatt
ctcatcagtaaagatgtacctcagaacccaggaggtgaaagcacaacttcagtgactgac
ttactaaactactttctggctccagaggttcttactggggagaaccaatactactgtgaa
agctgtgcctctctacagaacgcagagaaaactatgcaaatcacggaggagcctgagtat
cttatccttacgctcctgagattctcctacgatcagaagtaccatgtgagaagaaaaatt
ttagacaatgtgtcactgcctctggttttggagttgccagttaaaagaactgcttccttc
tcttccttgtcccagagttggtctgtagatgttgacttcactgatattaatgagaaccta
cctaaaaaattaaaaccttctgggactgaagaagctttctgccccaaattagtgccctac
ctattaagttctgttgttgtgcactctggtgtgtcctctgagagtggccattactactct
tatgccagaaacatcacaggtacagagtcttcataccagatgtgcccccagtctgaaagt
ctggcattagcaccctcccagagttgtttactaggggtagaaagccccaatacagtcatt
gaacaggacttggaaaataaggaaatgtcacaagagtggtttttatttaatgacagcagg
gtgacatttacttcatttcagtcagttcagaaaatcacaagtaggtttccaaaagacaca
gcttatgtgcttttgtacaaaaaacaaagcagagctaatggcatagacagtgacaatcca
gccagtggtgtctgggccaatggagatccacccctacagaaagagctgatggatgccata
acaaaggacaacaagctgtatttgcaggaacaagaattgaatgctcgagcccgggccctg
caagctgcatctgcttcctgttcgttccgacccaatggatttgatgacaatgacccacca
ggaagctgtgggccaactggtgggggcggtggaggaggcttcaatacagttggcagactc
gtattttga

DBGET integrated database retrieval system