KEGG   Mus musculus (mouse): 74996Help
Entry
74996             CDS       T01002                                 

Gene name
Usp47, 4930502N04Rik, A630020C16Rik
Definition
(RefSeq) ubiquitin specific peptidase 47 (EC:3.4.19.12)
  KO
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     74996 (Usp47)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   74996 (Usp47)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    74996 (Usp47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7; 7 F2
AA seq 1376 aa AA seqDB search
MVPGEENQLVPKEDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDTTNSKTVSERI
TLNLPASTPVRKLFEDVANKVGYINGTFDLTRENGVTTADMAPLDHTSDKSLLDANFEPG
KKNFLHLTDKDGEPPQMLLEDSNNVDDSVHDRFIGPLPREGSVASTNDYVSQNYSYSSIL
NKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEDSEEDPVTSIPYQLQRLF
VLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINEL
YQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPN
QYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTF
IDIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDAVDEGICLESSSGSEKISKPGL
EKNSLMYELFSVMVHSGSAAGGHYYACIKSFSDDQWYSFNDQHVSRITQEDIKKTHGGSS
GSRGYYSSAFASSTNAYMLIYRLKDPTRNAKFLEVDEYPEHIKNLVQKERELEEQEKRQR
EIERNTCKIKLFCLHPVKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEDVIPLDCCRLVK
YDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQIFQSYKPGEVMVKVHV
VDLKAETVAAPVTVRAYLNQTVTEFKQLISKATHLPADSMRIVLERCYNDLRLLSMPSKT
LKAEGFFRSNKVFVESSETVDHQAAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSYSKRT
AYQKAGGDSGNVDDDCERVKGPAGNLKSVDAILEESTEKLKSLSLQQQQQDGDNGDSSKS
TETSDFENIESPLNERGSSTSVDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDS
DILSSSHSSDTLCNADSAQIPLANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEY
DESGKSRGDMQYMYFKADPYTADEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSH
FKVFRVYTSNQEFETVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVCQLLVNEQEPCK
FLLDAVFAKGMTVRQSKEELIPQLREQCGLDLSIDRFRLRKKTWKNPGTVFLDYHIYEED
INISSNWEVFLEVLDGVEKMKSMSQLAILTRRWRPAEMKLDPFQELVLESNSVDELREKL
SEISGIPLEDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRD
RTEEVMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDVAQD
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggcgaggagaaccaactggtcccgaaggaggatgtgttttggagatgcaga
caaaatatctttgatgaaatgaagaagaaatttttacagatagaaaatgctgctgaagaa
cctagagtcttatgtataatacaagacactactaactcgaagacagtgagtgaacggatc
acattaaatttaccagcatctaccccagtccgaaagctctttgaagatgtggccaacaaa
gtaggctacataaatggaacctttgatttgaccagggaaaatggagtcactactgctgac
atggcaccactggatcacaccagtgacaagtctcttcttgatgctaattttgagccagga
aagaagaactttctgcatttgacagataaagatggtgaaccgcctcagatgttgttggag
gactccaataacgtggatgacagcgtgcatgacaggttcataggtccactgccaagagaa
ggttctgtggcctctaccaatgattatgtcagccagaactactcctattcatcaattttg
aacaagtcagaaactggttatgtgggattagtaaaccaggcgatgacgtgctatttgaat
agccttttgcaaacactttttatgactcctgaatttaggaatgcattatataagtgggaa
tttgaagactctgaagaagatcctgtaacgagtatcccataccagcttcaaaggcttttt
gttttgttacaaaccagcaaaaagagagcaattgagaccacagatgttacaaggagcttt
ggatgggatagcagtgaggcttggcaacagcatgatgtacaagaactgtgccgtgttatg
tttgatgctttggaacagaaatggaagcaaacagaacaggctgatcttataaatgagctg
taccaaggcaagctgaaagattatgtgaggtgtctggaatgcggttatgaaggctggaga
attgacacgtatcttgatattccactggtcatccgaccttatgggtccagccaagcgttt
gctagtgtggaagaagcgttgcatgcatttattcaaccagagatcttggatggcccaaat
caatatttttgtgaacgttgtaagaagaagtgtgatgctcggaagggccttcggtttttg
catttcccctatctgctgaccttacagttgaaaaggtttgattttgattatacaaccatg
catagaattaaactgaatgatcgaatgtcatttccggaggagctggatatgagcacattt
attgatattgaagatgagaaatctcctcagactgaaagttgcactgatagtggagcagaa
aatgaaggcagttgccacagcgaccagatgagtaatgatttctccacggatgatgctgtt
gatgaagggatatgcctggagagcagtagtgggagtgagaagatttcaaaacctggcctg
gaaaagaactccctgatgtatgagctcttctcagtgatggtgcattcagggagtgctgct
ggaggacactattatgcttgcataaagtctttcagtgacgatcaatggtacagtttcaat
gaccaacatgtgagcaggataacacaagaagacattaagaagacacatggtgggtcttca
ggaagcagaggctactactccagtgcttttgcaagctcaacaaatgcatatatgctgata
tacagactgaaggatccaacaagaaatgcaaagtttctagaagtggacgagtacccagaa
cacattaagaatctggtgcagaaggagagagagctggaagagcaggaaaagaggcaacga
gagattgaacgcaacacgtgcaagataaaattattttgtttgcatcctgtgaaacaagta
atgatggaaaacaagctggaggttcataaggataagacgctaaaggaagccgttgaaatg
gcttataagatgatggatttagaagatgtgattcccttggattgctgtcgcctggtaaaa
tatgacgagtttcatgattacctggaacgatcgtatgagggagaagaagatacaccaatg
gggttgcttctaggaggagtcaagtccacatacatgtttgatctgctgttggaaacgaga
aagcctgatcaaatttttcagtcttacaaacctggagaagtgatggtgaaagttcatgtt
gttgatctgaaagcagagactgtcgctgctcctgtaacagtgcgtgcgtatttaaatcag
acagttacagagtttaaacagctgatctcaaaggccacgcacttacctgcagactccatg
aggatagtgctggagcgctgctacaatgacctgcgccttctcagcatgcccagcaagacc
ctgaaggctgagggcttcttcagaagtaacaaggtgtttgttgaaagctctgagacagtg
gatcaccaggcagcctttacagactcccacttgtggaaactcctggatcgacatgcaaat
acaatccggttatttgttttgctgcctgaacaatctccaggatcatattcgaaaaggaca
gcataccagaaagctggaggtgattctggtaatgtggacgatgattgtgaaagagtcaaa
ggacctgcagggaatttaaagtctgtggatgctattctagaagagagcactgaaaaactg
aaaagcttgtcactgcagcagcagcagcaagatggggacaacggagacagcagcaaaagc
actgagacaagtgactttgaaaatattgaatcccctctcaatgagaggggctcttccacc
tctgtggataatcgagaacttgaacagcacattcagacttctgacccagaaaactttcag
tctgaggaacgctcggactcagatgtgaataatgaccggagtacaagttcggtagacagt
gatattcttagctccagtcacagcagtgacactttgtgcaatgcagacagcgctcagatt
cctctggccaatggacttgactctcacagtatcacaagtagtagaagaactaaagcaaac
gaggggaaaaaggagacctgggacacagctgaagaagactctgggactgacagtgaatat
gacgagagtggcaagagcaggggggacatgcagtacatgtacttcaaagctgacccctac
actgcggatgaaggctctggggaaggacacaaatggttgatggtgcatgttgataagaga
atcaccctggcagctttcaaacagcatttagaaccttttgttggagtcctctcctctcac
ttcaaggtttttcgagtgtacaccagcaatcaagagtttgagaccgtccggttgaatgag
accctttcatcattttcagatgacaataagatcacaatccgactggggagagcactgaag
aagggagagtacagagttaaagtgtgccagctcttagtcaatgagcaagagccatgcaag
tttctgctagacgctgtgtttgctaaaggcatgactgtgcggcaatcaaaagaggagctg
attcctcaactcagggagcagtgtggcttagacctcagcatcgacaggtttcgtctaagg
aagaaaacatggaagaatcctggcactgtctttttggattatcatatttatgaagaagat
attaatatttccagcaactgggaagttttcctggaagttcttgatggtgtggagaagatg
aagtccatgtcacagcttgccatcttaacaagacgctggaggcctgcagagatgaagttg
gaccccttccaggagcttgtgttggaaagcaatagtgttgatgaactccgagagaagcta
agtgaaatcagtgggattcctttggaagacattgaatttgccaagggtaggggaaccttc
ccctgtgatatttctgtccttgatattcatcaagatttggactggaatcctaaagtctct
accctgaatgtttggcctctttatatctgtgatgatggtgccgtcatattttatagggat
agaacagaagaagtgatggaattgacagatgagcaaagaaatgaattgatgaaaaaggaa
agcagccgactgcagaagacgggacatcgtgtgacatactcccctcgcaaagagaaagca
ctcaagatctacctggatggggcgccaaataaagatgtggctcaagactga

DBGET integrated database retrieval system