KEGG   Mus musculus (mouse): 75410Help
Entry
75410             CDS       T01002                                 

Gene name
Kmt2b, 2610014H22Rik, Mll2, Wbp7, mKIAA0304
Definition
lysine (K)-specific methyltransferase 2B (EC:2.1.1.43)
Orthology
K14959  
histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    75410 (Kmt2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     75410 (Kmt2b)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    75410 (Kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 B1; 7
AA seq 2722 aa AA seqDB search
MAAAAGGGSCPGPGSARGRFPGRPRGSGGGGGRGGRGNGAERVRVALRRGGGAAGPGGAE
PGEDTALLRLLGLRRGLRRLRRLWAGARVQRGRGRGRGRGWGPNRGCMPEEESSDGESEE
EEFQGFHSDEDVAPSSLRSALRSQRGRAPRGRGRKHKTTPLPPRLADVTPVPPKAPTRKR
GEEGTERMVQALTELLRRSQAPQPPRSRARAREPSTPRRSRGRPPGRPAGPCRKKQQAVV
LAEAAVTIPKPEPPPPVVPVKNKAGSWKCKEGPGPGPGTPKRGGQPGRGGRGGRGRGRGG
LPLMIKFVSKAKKVKMGQLSQELESGQGHGQRGESWQDAPQRKDGDEPERGSCRKKQEQK
LEEEEEEEEKEGEEKEEKDDNEDNNKQEEEEETERAVAEEEAMLAKEKEEAKLPSPPLTP
PVPSPPPPLPPPSTSPPPPASPLPPPVSPPPPLSPPPYPAPEKQEESPPLVPATCSRKRG
RPPLTPSQRAEREAARSGPEGTLSPTPNPSTTTGSPLEDSPTVVPKSTTFLKNIRQFIMP
VVSARSSRVIKTPRRFMDEDPPKPPKVEASIVRPPVATSPPAPQEPVPVSSPPRVPTPPS
TPVPLPEKRRSILREPTFRWTSLTRELPPPPPAPPPAPSPPPAPATPSRRPLLLRAPQFT
PSEAHLKIYESVLTPPPLGALETPEPELPPADDSPAEPEPRAVGRTNHLSLPRFVPVVTS
PVKVEVPPHGAPALSEGQQLQLQQPPQALQTQLLPQALPPQQPQAQPPPSPQHTPPLEKA
RVASLGSLPLSGVEEKMFSLLKRAKVQLFKIDQQQQQKVAASMPLSPAVQTEEAVGTVKQ
TPDRGCVRSEDESMEAKRDRASGPESPLQGPRIKHVCRHAAVALGQARAMVPEDVPRLSA
LPLRDRQDLATEDTSSASETESVPSRSQREKVESAGPGGDSEPTGSTGALAHTPRRSLPS
HHGKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMER
LAKKGRTIVKTLLPWDSDESPEASPGPPGPRRGAGAGGSREEVGATPGPEEQDSLLLQRK
SARRCVKQRPSYDVFEDSDDSEPGGPPAPRRRTPREHELPVLEPEEQSRPRKPTLQPVLQ
LKARRRLDKDALAPGPFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLT
SVPGGPPMVCLLCASKGLHELVFCQVCCDPFHPFCLEEAERPSPQHRDTWCCRRCKFCHV
CGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACVRCKSCGATPGKNW
DVEWSGDYSLCPRCTELYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDE
DYEILSGLPDSVLYTCGPCAGATQPRWREALSGALQGGLRQVLQGLLSSKVAGPLLLCTQ
CGQDGKQLHPGPCDLQAVGKRFEEGLYKSVHSFMEDVVAILMRHSEEGETPERRAGSQMK
GLLLKLLESAFCWFDAHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQESETPESG
QPPGDPSAAFQSKDPAAFSHLDDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIW
SAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIF
QDDKKVFCQKHTDLLDGKEIVTPDGFDVLRRVYVDFEGINFKRKFLTGLEPDVINVLIGS
IRINSLGTLSDLSDCEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPVH
LEAAEENQTIVHSPTPSSEPPNHDDLPDTDSLIPGDPVHHSPIQNLDPPLRTDSSNGPPP
TPRSFSGARIKVPNYSPSRRPLGGVSFGPLPSPGSPSSLTHHIPTVGDSDFPAPPRRSRR
PSPLATRPPPSRRTSSPLRTSPQLRVPLSTSVTALTPTSGELAPPDLAPSPLPPSEDLGP
DFEDMEVVSGLSAADLDFAASLLGTEPFQEEIVAAGAVGSSQGGPGDSSEEEASPTTHYV
HFPVTVVSGPALAPSSLAGAPRIEQLDGVDDGTDSEAEAVQQPRGQGTPPSGPGVGRGGV
LGAAGDRAQPPEDLPSEIVDFVLKNLGGPGEGAAGPREDSLPSAPPLANGSQPPQSLSTS
PADPTRTFAWLPGAPGVRVLSLGPAPEPPKPATSKIILVNKLGQVFVKMAGEGEPVAPPV
KQPPLPPIIPPTAPTSWTLPPGPLLSVLPVVGVGVVRPAPPPPPPPLTLVFSSGPPSPPR
QAIRVKRVSTFSGRSPPVPPPNKTPRLDEDGESLEDAHHVPGISGSGFSRVRMKTPTVRG
VLDLNNPGEQPEEESPGRPQDRCPLLPLAEAPSQALDGSSDLLFESQWHHYSAGEASSSE
EEPPSPEDKENQVPKRVGPHLRFEISSDDGFSVEAESLEVAWRTLIEKVQEARGHARLRH
LSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAE
VYLRKCTFDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTS
KEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRM
DDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFP
IEDASNKLPCNCGAKRCRRFLN
NT seq 8169 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcggcggcagttgccccgggcctggctccgcacggggccgcttc
ccgggccggccgcggggttccggcgggggcgggggccgcggcggccgaggcaacggagcc
gaaagagtgcgggtagccctgcggcgcggtggcggcgcggcggggccgggaggagccgag
cccggggaggacacggccctgctccgtttgctgggtcttcgccggggcctgcgccggctc
cgccgcctgtgggctggtgcgcgagttcagcgaggccgaggccgcggccggggacggggc
tggggcccgaaccgaggctgcatgccggaggaagagagcagtgacggggaatccgaggag
gaggagtttcagggttttcattcagatgaagatgtggcccccagttccctgcgctctgcg
cttcggtcccagcgaggtcgagcccctcggggtcggggccgcaagcataagacgaccccc
cttcctcctcgcctagcagatgtgactcctgtccccccaaaggcccctactcggaaacgg
ggtgaggagggcacagaacggatggtgcaggcactgactgaacttctccggcggtcccaa
gcaccccaacccccccggagccgggcacgggcacgtgaaccctctactccccgacggtct
cggggaaggcccccaggacggccagccggtccctgccggaaaaagcagcaagcagtagtg
ttagcagaagcggctgtgacaatccctaaacccgagcctccgccccctgtggttccagta
aagaacaaagctggcagttggaaatgcaaggagggacctggtccaggacctggaaccccc
aaacgtggaggacagcctgggagaggaggccgtggaggcaggggcagaggccgaggcgga
cttccccttatgatcaagtttgtttccaaggccaagaaagtgaagatgggacaattgtcc
caggaactagaatcaggtcagggtcatggtcaacgtggggaaagctggcaggatgccccc
caaagaaaagatggagatgaaccagaaaggggctcgtgtagaaagaaacaggagcagaaa
ctggaggaggaggaggaggaggaggagaaggagggagaagagaaggaagaaaaagatgac
aatgaggataacaacaagcaagaggaagaggaggagactgagagagctgtggctgaggaa
gaagcgatgctagccaaggagaaggaagaggcaaagcttccgtcaccacccttgactcct
ccagtcccttcaccacctcctcctctaccacccccttcaacatctcctccacctccagca
tcccctctaccacccccagtttctcctcctcccccactttcccctcccccatatccagcc
ccagagaagcaggaagagtctcctcctcttgtcccagctacatgctctaggaagaggggc
aggcctcccctgactcctagccagcgggcagagagggaagctgctcggtcaggaccagag
ggcaccctttctcccactccaaaccctagcaccaccacaggaagccctttggaagacagt
cctactgtggtccccaaaagtaccacctttttaaagaatatacggcagtttattatgcct
gtagtgagtgctcgctcctcccgtgttatcaagacaccccggcgatttatggatgaagat
cctcccaaacctccaaaggtggaggcttctattgttcgacctcctgttgcaacctcccca
cctgctccccaggaaccagtaccagtctcctctccacctcgtgtcccaactcccccatct
accccagtcccactccctgagaagaggcggtctatcctaagggaacccacatttcgctgg
acctcactaacccgggagctgccgccacctccacctgctcctccaccagccccatctcca
ccacctgcccctgccactccctcccggaggcccttgctccttcgggcccctcagtttacc
ccaagtgaagcccacctgaagatctatgaatcggtgcttacccctcctcctcttggggct
cttgaaacccctgagccagagctgcctcctgctgatgactctccagcagagcctgagcct
agggcagtggggcggaccaatcacctcagcttgcctcgctttgtccctgtggtcaccagt
cctgttaaggttgaggtgcccccccatggagctccagctctgagtgaaggccagcagctt
cagctccagcagcccccgcaggccttgcagacccagctcctaccccaggcactaccacca
cagcaaccacaagcgcagccacctccatcaccacaacacacaccaccactggaaaaggcc
cgtgttgcaagtctgggttccctgccactatctggggtggaggagaaaatgtttagcctt
cttaagagagctaaggtgcagttattcaagatcgatcaacagcaacagcagaaagtggcg
gcttcaatgccgctaagccctgcagtacaaaccgaggaggctgtggggactgtcaaacag
accccggacagaggctgtgtcaggtctgaagatgaatccatggaagctaagagagatcga
gcctcgggccctgagtcacctttacaaggcccccgaatcaaacatgtctgccgtcacgct
gctgtggccttgggtcaggctcgggccatggtgcctgaagatgtaccccgcctcagtgcc
ctccctctccgggatcggcaggacctcgccactgaggatacgtcatcagcatcagagact
gagagtgtcccttcccgatcccagcgggaaaaggtggaatctgcagggcctgggggagac
tcggagcctacagggtctacaggggccctggcccacacaccacggcggtcactgccatcc
caccatggcaagaagatgagaatggctcgttgtgggcactgtcggggttgcttgcgtgtg
caggactgtggctcttgtgtcaactgcttggataaacctaaatttgggggtcccaacact
aagaagcagtgctgtgtataccggaagtgtgacaagatagaggctcggaagatggagcgg
ctggcaaaaaaaggccggacgatagtgaagacgctgttgccctgggattccgatgaatct
cctgaggcctcccctggtcctccaggcccacgccggggggcgggagctggggggtcccgg
gaggaggtgggggccactcccgggcccgaggagcaggactccctcctactgcagcgcaag
tcagcccgacgctgcgtcaaacagcggccctcctatgatgtcttcgaggactcagatgac
tcagagcccgggggtcctcctgctccaagacgtcgcacccccagagaacatgagctgcca
gtactagaacctgaggagcagagccggccccgcaaacccaccctgcagcctgtgttgcag
ctcaaggcccgaaggcgcctggacaaggatgctttagcccctggcccctttgcctctttt
cccaatggctggactggaaagcagaagtctcctgacggtgtgcaccgggtccgagtagat
tttaaggaggattgcgacctagagaatgtgtggcttatgggtggtctcagtgtgctgact
tctgtgccaggggggccaccgatggtgtgtctgctgtgtgctagcaaaggcctccatgag
ctggttttttgccaagtctgctgcgatcctttccaccccttctgtctggaggaggctgag
cggccctcacctcagcatcgtgacacctggtgctgcaggcgctgcaagttctgccatgtt
tgtgggcgcaaaggccgagggtccaagcacctcctggaatgtgaacgctgtcgtcatgct
taccacccagcctgcctgggacccagctacccaacccgggccacgcgtagacggcgccac
tggatctgttcagcctgtgtgcgctgtaagagctgtggggcaactccaggcaagaactgg
gatgtcgagtggtctggagattacagcctctgccccaggtgcaccgagctctatgaaaaa
gggaactactgcccaatttgcacacgctgctatgaagacaatgactatgagagcaagatg
atgcagtgtgcacagtgtgaccactgggtgcatgccaagtgtgagggactctcagatgaa
gactacgagatcctttctggactgccagactcagtgttgtacacgtgtgggccatgtgct
ggggcgacacagccccgctggcgagaggccctgagtggggccctgcagggaggcctgcgt
caggtgctccagggcctgttaagctcaaaggtggcaggcccattgctgctgtgcacccag
tgtgggcaggatgggaagcagctccacccaggaccctgtgatttacaagctgtgggaaag
cgctttgaggaaggtctctataagtctgtgcacagcttcatggaagacgtagtggccatc
ttgatgaggcattcagaagaaggagagaccccagagcgccgggctggaagccagatgaaa
ggactcctactgaagctgctagagtctgcgttctgctggtttgacgcccatgatcctaag
tactggcgacggagtacacggctgccaaacggagtgctccccaatgctgtgttgcctcca
tccttggaccatgtctatgctcagtggagacaacaggaatcagagaccccagaatcgggg
cagcctccaggggatccttcagcagctttccagagcaaggacccagctgctttctcacac
ctggatgaccctcgtcagtgtgcactctgtctcaagtatggggatgctgactctaaggag
gcggggcggctcctgtacattgggcagaatgagtggacacatgtcaattgtgccatttgg
tcagctgaagtgtttgaggagaatgatggctccctcaagaacgtccatgctgctgttgca
cgtggaaggcagatgcgctgtgagctctgcctcaagcctggagccacagttggctgctgc
ctgtcctcatgtctcagcaacttccacttcatgtgtgcccgggccagctactgcatcttc
caggatgacaagaaggttttctgccagaaacacacagacctcctagatggcaaggagatc
gtgacccctgatggttttgatgttcttcggcgagtctatgtggacttcgagggcatcaac
ttcaagcgaaagttcttgactggacttgaaccagatgtcatcaatgtactcattggctcc
atcagaatcaactccctgggcaccctatctgatctctcagactgtgagggtcgactcttc
cccattggctaccaatgctcccgcctgtattggagcacagtggatgctcggaggcgctgc
tggtatcggtgccgaattctagagtatcgcccttgggggccaagggaggagccagtgcac
ctagaagcagcagaggagaaccagaccattgtgcatagcccaaccccttcctcagagccc
cccaatcatgatgatctgccagatacagattctctgatccctggagatcctgtacaccac
tcccccattcagaatctggatcccccgcttcggacagattcaagcaatggccctcctccc
acccctcgctccttctcaggggctcgaatcaaagtgcccaactactcaccgtctcggagg
cccttagggggagtctcttttggtcctctgccctctccaggaagtccatcttccctgacc
caccacatccctactgtgggagactcggactttccagctcccccaaggcgatctcggcgt
cctagccccctggccaccaggccaccaccatcccggaggacctcctctcctctcagaact
tcccctcagctcagggtgcccctgtctacctcagtcacagccctcacacctacctcaggg
gagctggctccccctgacctggccccatctccccttccaccgtctgaagacctgggccca
gactttgaagacatggaggtggtgtcaggactaagtgctgctgacctggactttgcagcc
agcctgctggggactgagcctttccaggaagagattgtggctgctggggcagtggggagc
agccagggaggtccaggggacagctcagaggaggaggccagccctaccactcactatgtc
cacttccctgtgaccgtggtgtctggccctgccctggcccccagttcccttgctggagct
ccccgaatcgagcagctggacggagtggatgatggcacagacagcgaggctgaggctgtc
caacaaccccggggacaggggactcctccttcaggaccaggagtgggccgaggaggggtc
cttggagcagcaggcgacagagcccaacctcctgaagacctgccttcagaaattgtggat
ttcgtgttgaagaacctagggggtcctggggagggggctgctggccccagagaggactct
cttccttcagcacctcccttggctaatggcagccaacccccacaaagcctgtccactagc
ccagctgaccccacccgaacatttgcttggctccctggagctccaggggtccgggtattg
agtctgggtcctgctccagaaccccccaaacctgccacatccaagatcatccttgtcaac
aagctggggcaagtatttgtgaagatggcaggggagggtgagcctgtagcacccccagta
aagcagccccctctaccccccatcattcccccaacagctcccacctcctggactctgccc
ccaggacccctgctcagtgtgttaccagtggtaggggtaggagtggtccggcctgcccca
cccccacctccacccccactaacactggtgtttagcagtgggccccccagcccaccacgc
caggccattcgtgtcaagagggtatccaccttctctggccgatcccctccagttcctccc
ccaaacaaaactccccggctggatgaagatggagagtccttggaggatgcccatcatgtg
ccagggatcagtggcagtgggttcagtcgtgttcgcatgaaaacgcccacagtccgtgga
gttctggacctgaacaatcctggggagcagcctgaggaggaaagccctgggcgcccccag
gaccggtgtcctttgctgccacttgcagaagctccttcccaggccctcgatggttcctca
gacctactgtttgagtcccagtggcatcactattcagcaggcgaggcctcaagctctgag
gaagagcctccatctccagaggacaaagaaaaccaggtccccaaacgggttggtccacac
ctgcgctttgagatcagcagtgatgatggcttcagtgtggaggcagagagcttggaggtg
gcatggagaactctgattgagaaagtgcaagaagcacgagggcatgcacggctcaggcat
ctctcctttagtggaatgagtggagcgcggctcctgggcatccaccacgatgctgtcatc
ttcctggcagagcagctccctggggcccagcgctgccagcattataagttccgctaccac
cagcagggagagggccaggaagagccacctctgaatccccatggggctgctcgtgctgag
gtctatctccggaagtgtacctttgacatgttcaacttcctggcctcccagcaccgtgtg
ctccccgagggagccacctgtgatgaagaagaggatgaggtgcagcttcggtccaccaga
cgtgccaccagcctggagcttcctatggccatgcgctttcgtcatctcaaaaagacatcc
aaagaggctgtgggagtctacagatcagctatccatggacgaggtctgttttgtaaacgc
aacatcgatgcgggagagatggtcattgagtactctggcattgtcattcgctctgtgctg
actgacaagcgagagaagttctatgatgggaagggtattgggtgctacatgttccgcatg
gatgactttgatgtggtggacgccaccatgcacggcaatgctgcccgattcatcaaccac
tcatgtgagcccaactgcttctctcgtgtcatccatgtggaaggccagaaacacattgtc
atctttgccttgcgccgcatcctgcgaggtgaggagctcacctatgactacaagtttcct
atcgaggatgccagcaacaagctgccctgcaactgtggcgccaagcgctgccgtcgcttt
cttaactga

DBGET integrated database retrieval system