KEGG   Mus musculus (mouse): 75410Help
Entry
75410             CDS       T01002                                 

Gene name
Kmt2b, 2610014H22Rik, Mll2, Wbp7, mKIAA0304
Definition
lysine (K)-specific methyltransferase 2B (EC:2.1.1.43)
Orthology
K14959  
histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mmu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 B1; 7
AA seq 2713 aa AA seqDB search
MAAAAGGGSCPGPGSARGRFPGRPRGSGGGGGRGGRGNGAERVRVALRRGGGAAGPGGAE
PGEDTALLRLLGLRRGLRRLRRLWAGARVQRGRGRGRGRGWGPNRGCMPEEESSDGESEE
EEFQGFHSDEDVAPSSLRSALRSQRGRAPRGRGRKHKTTPLPPRLADVTPVPPKAPTRKR
GEEGTERMVQALTELLRRSQAPQPPRSRARAREPSTPRRSRGRPPGRPAGPCRKKQQAVV
LAEAAVTIPKPEPPPPVVPVKNKAGSWKCKEGPGPGPGTPKRGGQPGRGGRGGRGRGRGG
LPLMIKFVSKAKKVKMGQLSQELESGQGHGQRGESWQDAPQRKDGDEPERGSCRKKQEQK
LEEEEEEEEKEGEEKEEKDDNEDNNKQEEEEETERAVAEEEAMLAKEKEEAKLPSPPLTP
PVPSPPPPLPPPSTSPPPPASPLPPPVSPPPPLSPPPYPAPEKQEESPPLVPATCSRKRG
RPPLTPSQRAEREAARSGPEGTLSPTPNPSTTTGSPLEDSPTVVPKSTTFLKNIRQFIMP
VVSARSSRVIKTPRRFMDEDPPKPPKVEASIVRPPVATSPPAPQEPVPVSSPPRVPTPPS
TPVPLPEKRRSILREPTFRWTSLTRELPPPPPAPPPAPSPPPAPATPSRRPLLLRAPQFT
PSEAHLKIYESVLTPPPLGALETPEPELPPADDSPAEPEPRAVGRTNHLSLPRFVPVVTS
PVKVEVPPHGAPALSEGQQLQLQQPPQALQTQLLPQALPPQQPQAQPPPSPQHTPPLEKA
RVASLGSLPLSGVEEKMFSLLKRAKVQLFKIDQQQQQKVAASMPLSPAVQTEEAVGTVKQ
TPDRGCVRSEDESMEAKRDRASGPESPLQGPRIKHVCRHAAVALGQARAMVPEDVPRLSA
LPLRDRQDLATEDTSSASETESVPSRSQREKVESAGPGGDSEPTGSTGALAHTPRRSLPS
HHGKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMER
LAKKGRTIVKTLLPWDSDESPEASPGPPGPRRGAGAGGSREEVGATPGPEEQDSLLLQRK
SARRCVKQRPSYDVFEDSDDSEPGGPPAPRRRTPREHELPVLEPEEQSRPRKPTLQPVLQ
LKARRRLDKDALAPGPFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLT
SVPGGPPMVCLLCASKGLHELVFCQVCCDPFHPFCLEEAERPSPQHRDTWCCRRCKFCHV
CGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACVRCKSCGATPGKNW
DVEWSGDYSLCPRCTELYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDE
DYEILSGLPDSVLYTCGPCAGATQPRWREALSGALQGGLRQVLQGLLSSKVAGPLLLCTQ
CGQDGKQLHPGPCDLQAVGKRFEEGLYKSVHSFMEDVVAILMRHSEEGETPERRAGSQMK
GLLLKLLESAFCWFDAHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQESETPESG
QPPGDPSAAFQSKDPAAFSHLDDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIW
SAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIF
QDDKKVFCQKHTDLLDGKEIVTPDGFDVLRRVYVDFEGINFKRKFLTGLEPDVINVLIGS
IRINSLGTLSDLSDCEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPVH
LEAAEENQTIVHSPTPSSDTDSLIPGDPVHHSPIQNLDPPLRTDSSNGPPPTPRSFSGAR
IKVPNYSPSRRPLGGVSFGPLPSPGSPSSLTHHIPTVGDSDFPAPPRRSRRPSPLATRPP
PSRRTSSPLRTSPQLRVPLSTSVTALTPTSGELAPPDLAPSPLPPSEDLGPDFEDMEVVS
GLSAADLDFAASLLGTEPFQEEIVAAGAVGSSQGGPGDSSEEEASPTTHYVHFPVTVVSG
PALAPSSLAGAPRIEQLDGVDDGTDSEAEAVQQPRGQGTPPSGPGVGRGGVLGAAGDRAQ
PPEDLPSEIVDFVLKNLGGPGEGAAGPREDSLPSAPPLANGSQPPQSLSTSPADPTRTFA
WLPGAPGVRVLSLGPAPEPPKPATSKIILVNKLGQVFVKMAGEGEPVAPPVKQPPLPPII
PPTAPTSWTLPPGPLLSVLPVVGVGVVRPAPPPPPPPLTLVFSSGPPSPPRQAIRVKRVS
TFSGRSPPVPPPNKTPRLDEDGESLEDAHHVPGISGSGFSRVRMKTPTVRGVLDLNNPGE
QPEEESPGRPQDRCPLLPLAEAPSQALDGSSDLLFESQWHHYSAGEASSSEEEPPSPEDK
ENQVPKRVGPHLRFEISSDDGFSVEAESLEVAWRTLIEKVQEARGHARLRHLSFSGMSGA
RLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTFD
MFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYRS
AIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDAT
MHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLP
CNCGAKRCRRFLN
NT seq 8142 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcggcggcagttgccccgggcctggctccgcacggggccgcttc
ccgggccggccgcggggttccggcgggggcgggggccgcggcggccgaggcaacggagcc
gaaagagtgcgggtagccctgcggcgcggtggcggcgcggcggggccgggaggagccgag
cccggggaggacacggccctgctccgtttgctgggtcttcgccggggcctgcgccggctc
cgccgcctgtgggctggtgcgcgagttcagcgaggccgaggccgcggccggggacggggc
tggggcccgaaccgaggctgcatgccggaggaagagagcagtgacggggaatccgaggag
gaggagtttcagggttttcattcagatgaagatgtggcccccagttccctgcgctctgcg
cttcggtcccagcgaggtcgagcccctcggggtcggggccgcaagcataagacgaccccc
cttcctcctcgcctagcagatgtgactcctgtccccccaaaggcccctactcggaaacgg
ggtgaggagggcacagaacggatggtgcaggcactgactgaacttctccggcggtcccaa
gcaccccaacccccccggagccgggcacgggcacgtgaaccctctactccccgacggtct
cggggaaggcccccaggacggccagccggtccctgccggaaaaagcagcaagcagtagtg
ttagcagaagcggctgtgacaatccctaaacccgagcctccgccccctgtggttccagta
aagaacaaagctggcagttggaaatgcaaggagggacctggtccaggacctggaaccccc
aaacgtggaggacagcctgggagaggaggccgtggaggcaggggcagaggccgaggcgga
cttccccttatgatcaagtttgtttccaaggccaagaaagtgaagatgggacaattgtcc
caggaactagaatcaggtcagggtcatggtcaacgtggggaaagctggcaggatgccccc
caaagaaaagatggagatgaaccagaaaggggctcgtgtagaaagaaacaggagcagaaa
ctggaggaggaggaggaggaggaggagaaggagggagaagagaaggaagaaaaagatgac
aatgaggataacaacaagcaagaggaagaggaggagactgagagagctgtggctgaggaa
gaagcgatgctagccaaggagaaggaagaggcaaagcttccgtcaccacccttgactcct
ccagtcccttcaccacctcctcctctaccacccccttcaacatctcctccacctccagca
tcccctctaccacccccagtttctcctcctcccccactttcccctcccccatatccagcc
ccagagaagcaggaagagtctcctcctcttgtcccagctacatgctctaggaagaggggc
aggcctcccctgactcctagccagcgggcagagagggaagctgctcggtcaggaccagag
ggcaccctttctcccactccaaaccctagcaccaccacaggaagccctttggaagacagt
cctactgtggtccccaaaagtaccacctttttaaagaatatacggcagtttattatgcct
gtagtgagtgctcgctcctcccgtgttatcaagacaccccggcgatttatggatgaagat
cctcccaaacctccaaaggtggaggcttctattgttcgacctcctgttgcaacctcccca
cctgctccccaggaaccagtaccagtctcctctccacctcgtgtcccaactcccccatct
accccagtcccactccctgagaagaggcggtctatcctaagggaacccacatttcgctgg
acctcactaacccgggagctgccgccacctccacctgctcctccaccagccccatctcca
ccacctgcccctgccactccctcccggaggcccttgctccttcgggcccctcagtttacc
ccaagtgaagcccacctgaagatctatgaatcggtgcttacccctcctcctcttggggct
cttgaaacccctgagccagagctgcctcctgctgatgactctccagcagagcctgagcct
agggcagtggggcggaccaatcacctcagcttgcctcgctttgtccctgtggtcaccagt
cctgttaaggttgaggtgcccccccatggagctccagctctgagtgaaggccagcagctt
cagctccagcagcccccgcaggccttgcagacccagctcctaccccaggcactaccacca
cagcaaccacaagcgcagccacctccatcaccacaacacacaccaccactggaaaaggcc
cgtgttgcaagtctgggttccctgccactatctggggtggaggagaaaatgtttagcctt
cttaagagagctaaggtgcagttattcaagatcgatcaacagcaacagcagaaagtggcg
gcttcaatgccgctaagccctgcagtacaaaccgaggaggctgtggggactgtcaaacag
accccggacagaggctgtgtcaggtctgaagatgaatccatggaagctaagagagatcga
gcctcgggccctgagtcacctttacaaggcccccgaatcaaacatgtctgccgtcacgct
gctgtggccttgggtcaggctcgggccatggtgcctgaagatgtaccccgcctcagtgcc
ctccctctccgggatcggcaggacctcgccactgaggatacgtcatcagcatcagagact
gagagtgtcccttcccgatcccagcgggaaaaggtggaatctgcagggcctgggggagac
tcggagcctacagggtctacaggggccctggcccacacaccacggcggtcactgccatcc
caccatggcaagaagatgagaatggctcgttgtgggcactgtcggggttgcttgcgtgtg
caggactgtggctcttgtgtcaactgcttggataaacctaaatttgggggtcccaacact
aagaagcagtgctgtgtataccggaagtgtgacaagatagaggctcggaagatggagcgg
ctggcaaaaaaaggccggacgatagtgaagacgctgttgccctgggattccgatgaatct
cctgaggcctcccctggtcctccaggcccacgccggggggcgggagctggggggtcccgg
gaggaggtgggggccactcccgggcccgaggagcaggactccctcctactgcagcgcaag
tcagcccgacgctgcgtcaaacagcggccctcctatgatgtcttcgaggactcagatgac
tcagagcccgggggtcctcctgctccaagacgtcgcacccccagagaacatgagctgcca
gtactagaacctgaggagcagagccggccccgcaaacccaccctgcagcctgtgttgcag
ctcaaggcccgaaggcgcctggacaaggatgctttagcccctggcccctttgcctctttt
cccaatggctggactggaaagcagaagtctcctgacggtgtgcaccgggtccgagtagat
tttaaggaggattgcgacctagagaatgtgtggcttatgggtggtctcagtgtgctgact
tctgtgccaggggggccaccgatggtgtgtctgctgtgtgctagcaaaggcctccatgag
ctggttttttgccaagtctgctgcgatcctttccaccccttctgtctggaggaggctgag
cggccctcacctcagcatcgtgacacctggtgctgcaggcgctgcaagttctgccatgtt
tgtgggcgcaaaggccgagggtccaagcacctcctggaatgtgaacgctgtcgtcatgct
taccacccagcctgcctgggacccagctacccaacccgggccacgcgtagacggcgccac
tggatctgttcagcctgtgtgcgctgtaagagctgtggggcaactccaggcaagaactgg
gatgtcgagtggtctggagattacagcctctgccccaggtgcaccgagctctatgaaaaa
gggaactactgcccaatttgcacacgctgctatgaagacaatgactatgagagcaagatg
atgcagtgtgcacagtgtgaccactgggtgcatgccaagtgtgagggactctcagatgaa
gactacgagatcctttctggactgccagactcagtgttgtacacgtgtgggccatgtgct
ggggcgacacagccccgctggcgagaggccctgagtggggccctgcagggaggcctgcgt
caggtgctccagggcctgttaagctcaaaggtggcaggcccattgctgctgtgcacccag
tgtgggcaggatgggaagcagctccacccaggaccctgtgatttacaagctgtgggaaag
cgctttgaggaaggtctctataagtctgtgcacagcttcatggaagacgtagtggccatc
ttgatgaggcattcagaagaaggagagaccccagagcgccgggctggaagccagatgaaa
ggactcctactgaagctgctagagtctgcgttctgctggtttgacgcccatgatcctaag
tactggcgacggagtacacggctgccaaacggagtgctccccaatgctgtgttgcctcca
tccttggaccatgtctatgctcagtggagacaacaggaatcagagaccccagaatcgggg
cagcctccaggggatccttcagcagctttccagagcaaggacccagctgctttctcacac
ctggatgaccctcgtcagtgtgcactctgtctcaagtatggggatgctgactctaaggag
gcggggcggctcctgtacattgggcagaatgagtggacacatgtcaattgtgccatttgg
tcagctgaagtgtttgaggagaatgatggctccctcaagaacgtccatgctgctgttgca
cgtggaaggcagatgcgctgtgagctctgcctcaagcctggagccacagttggctgctgc
ctgtcctcatgtctcagcaacttccacttcatgtgtgcccgggccagctactgcatcttc
caggatgacaagaaggttttctgccagaaacacacagacctcctagatggcaaggagatc
gtgacccctgatggttttgatgttcttcggcgagtctatgtggacttcgagggcatcaac
ttcaagcgaaagttcttgactggacttgaaccagatgtcatcaatgtactcattggctcc
atcagaatcaactccctgggcaccctatctgatctctcagactgtgagggtcgactcttc
cccattggctaccaatgctcccgcctgtattggagcacagtggatgctcggaggcgctgc
tggtatcggtgccgaattctagagtatcgcccttgggggccaagggaggagccagtgcac
ctagaagcagcagaggagaaccagaccattgtgcatagcccaaccccttcctcagataca
gattctctgatccctggagatcctgtacaccactcccccattcagaatctggatcccccg
cttcggacagattcaagcaatggccctcctcccacccctcgctccttctcaggggctcga
atcaaagtgcccaactactcaccgtctcggaggcccttagggggagtctcttttggtcct
ctgccctctccaggaagtccatcttccctgacccaccacatccctactgtgggagactcg
gactttccagctcccccaaggcgatctcggcgtcctagccccctggccaccaggccacca
ccatcccggaggacctcctctcctctcagaacttcccctcagctcagggtgcccctgtct
acctcagtcacagccctcacacctacctcaggggagctggctccccctgacctggcccca
tctccccttccaccgtctgaagacctgggcccagactttgaagacatggaggtggtgtca
ggactaagtgctgctgacctggactttgcagccagcctgctggggactgagcctttccag
gaagagattgtggctgctggggcagtggggagcagccagggaggtccaggggacagctca
gaggaggaggccagccctaccactcactatgtccacttccctgtgaccgtggtgtctggc
cctgccctggcccccagttcccttgctggagctccccgaatcgagcagctggacggagtg
gatgatggcacagacagcgaggctgaggctgtccaacaaccccggggacaggggactcct
ccttcaggaccaggagtgggccgaggaggggtccttggagcagcaggcgacagagcccaa
cctcctgaagacctgccttcagaaattgtggatttcgtgttgaagaacctagggggtcct
ggggagggggctgctggccccagagaggactctcttccttcagcacctcccttggctaat
ggcagccaacccccacaaagcctgtccactagcccagctgaccccacccgaacatttgct
tggctccctggagctccaggggtccgggtattgagtctgggtcctgctccagaacccccc
aaacctgccacatccaagatcatccttgtcaacaagctggggcaagtatttgtgaagatg
gcaggggagggtgagcctgtagcacccccagtaaagcagccccctctaccccccatcatt
cccccaacagctcccacctcctggactctgcccccaggacccctgctcagtgtgttacca
gtggtaggggtaggagtggtccggcctgccccacccccacctccacccccactaacactg
gtgtttagcagtgggccccccagcccaccacgccaggccattcgtgtcaagagggtatcc
accttctctggccgatcccctccagttcctcccccaaacaaaactccccggctggatgaa
gatggagagtccttggaggatgcccatcatgtgccagggatcagtggcagtgggttcagt
cgtgttcgcatgaaaacgcccacagtccgtggagttctggacctgaacaatcctggggag
cagcctgaggaggaaagccctgggcgcccccaggaccggtgtcctttgctgccacttgca
gaagctccttcccaggccctcgatggttcctcagacctactgtttgagtcccagtggcat
cactattcagcaggcgaggcctcaagctctgaggaagagcctccatctccagaggacaaa
gaaaaccaggtccccaaacgggttggtccacacctgcgctttgagatcagcagtgatgat
ggcttcagtgtggaggcagagagcttggaggtggcatggagaactctgattgagaaagtg
caagaagcacgagggcatgcacggctcaggcatctctcctttagtggaatgagtggagcg
cggctcctgggcatccaccacgatgctgtcatcttcctggcagagcagctccctggggcc
cagcgctgccagcattataagttccgctaccaccagcagggagagggccaggaagagcca
cctctgaatccccatggggctgctcgtgctgaggtctatctccggaagtgtacctttgac
atgttcaacttcctggcctcccagcaccgtgtgctccccgagggagccacctgtgatgaa
gaagaggatgaggtgcagcttcggtccaccagacgtgccaccagcctggagcttcctatg
gccatgcgctttcgtcatctcaaaaagacatccaaagaggctgtgggagtctacagatca
gctatccatggacgaggtctgttttgtaaacgcaacatcgatgcgggagagatggtcatt
gagtactctggcattgtcattcgctctgtgctgactgacaagcgagagaagttctatgat
gggaagggtattgggtgctacatgttccgcatggatgactttgatgtggtggacgccacc
atgcacggcaatgctgcccgattcatcaaccactcatgtgagcccaactgcttctctcgt
gtcatccatgtggaaggccagaaacacattgtcatctttgccttgcgccgcatcctgcga
ggtgaggagctcacctatgactacaagtttcctatcgaggatgccagcaacaagctgccc
tgcaactgtggcgccaagcgctgccgtcgctttcttaactga

DBGET integrated database retrieval system