KEGG   Mus musculus (mouse): 75477Help
Entry
75477             CDS       T01002                                 

Gene name
Pfn3, 1700012P12Rik
Definition
profilin 3
Orthology
K05759  
profilin
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    75477 (Pfn3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    75477 (Pfn3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    75477 (Pfn3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   75477 (Pfn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
13 B2; 13 30.06 cM
AA seq 137 aa AA seqDB search
MSDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI
LNKTVHDLIGGLREQCS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactggaagggctacatcagtgcagtgctgcgggatcagcggatcgatgacgtg
gctatcgtgggccactcggacaatcgctgtgtgtgggcatcacggcctgggggtctgctg
gctgccatctccccgcaggaggtgggtgtgctcaccgggccagaccggcacacctttctg
cagacgggtctgagcgtggcaggccgccgctgctgcgttatccgtgactacctgctggcc
gagggtgacggcgtactggatgcgcgcaccaaggggctagacgggcgtgcaatctgtgtg
ggccacacgccacgggcgctcctggtgctcatgggcagacgaggcgtgcatggaggcatc
ctcaataagacagtgcacgatctgattggtgggctgcgtgagcagtgctcttag

DBGET integrated database retrieval system