KEGG   Mus musculus (mouse): 75512Help
Entry
75512             CDS       T01002                                 

Gene name
Gpx6, 1700020G18Rik, Ry2d1, olfactory
Definition
glutathione peroxidase 6 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    75512 (Gpx6)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    75512 (Gpx6)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    75512 (Gpx6)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     75512 (Gpx6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 A3.1; 13
AA seq 221 aa AA seqDB search
MAQKLWGSCLFSLFMAALAQETLNPQKSKVDCNKGVTGTVYEYGANTIDGGEFVNFQQYA
GKHILFVNVASFCGLTATYPELNTLQEELKPFNVTVLGFPCNQFGKQEPGKNSEILLGLK
YVRPGGGYVPNFQLFEKGDVNGDNEQKVFSFLKNSCPPTSELFGSPEHLFWDPMKVHDIR
WNFEKFLVGPDGVPVMRWFHHTPVRIVQSDIMEYLNQTSTQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaagttgtggggttcctgtcttttctcattgtttatggctgccttagctcag
gagactctgaatcctcaaaaatcgaaggtggattgcaacaaaggggtgactggcaccgtc
tatgagtatggagccaacaccatagatggtggggagtttgtcaacttccagcagtatgca
ggaaagcacatcctctttgtcaacgtggcatccttctgtggcctgacagctacgtaccct
gagctgaacacattgcaggaggagctgaagccattcaacgtcacggttttgggctttcca
tgcaaccagtttggaaagcaagaacctggaaagaactcagagattctccttggactcaag
tatgtgcgtccaggcggtggctatgtccccaatttccagctctttgagaagggggatgtg
aacggagacaatgaacaaaaggttttttctttcctaaagaactcctgccctcccacctct
gaactttttggctctccagaacatctcttctgggatcccatgaaggttcatgatatccgc
tggaactttgagaagttcctggtgggacctgatggagtccctgtcatgcgctggttccac
catactcctgtcagaattgtccagtcagacatcatggagtacctaaaccaaaccagtacc
cagtaa

DBGET integrated database retrieval system