KEGG   Mus musculus (mouse): 75812Help
Entry
75812             CDS       T01002                                 

Gene name
Tasp1, 4930485D02Rik, AW986064
Definition
(RefSeq) taspase, threonine aspartase 1 (EC:3.4.25.-)
  KO
K08657  
taspase, threonine aspartase, 1 [EC:3.4.25.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.-  
     75812 (Tasp1)
Peptidases [BR:mmu01002]
 Threonine Peptidases
  Family T2
   75812 (Tasp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 F3
AA seq 420 aa AA seqDB search
MIMEKGMNSGEGLPSRSSQASAAKVTVKELETQQPCKEKRGGFVLVHAGAGYHSESKAKE
YKHVCKRACQKAIEKLQAGALATDAVAAALVELEDSPFTNAGIGSNLNLLGEIECDASIM
DGKSLNFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIP
SCPPSTMTTRFSLAAFKRNKRKLELAERVETDFIQLKRRRQSSAKENDSGTLDTVGAVVV
DHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAQNPYSTAVSTSGCGEHLVRT
ILARECSHALQAEDAHQALLETMQNKFISSPFLACEDGVLGGVIVLRSCRCSSESDSSQD
KQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgatcatggagaaggggatgaattctggagaaggactgccttccagatcatctcaggca
tctgctgctaaagtaacagtcaaggagttagaaacacagcagccctgtaaggagaaacga
gggggctttgtgctggtgcatgcaggtgcaggctatcattctgaatccaaagccaaggaa
tataaacatgtatgcaaacgagcttgtcagaaggcaattgagaagctacaggctggtgct
cttgctacagatgcagtggctgctgctctggtggaacttgaggattctccttttacaaat
gcaggaataggatctaatctaaatctcttaggagagattgaatgtgatgccagcataatg
gatggaaagtccttaaactttggagccgttggagcactgagtggaatcaagaatccagtc
tcagttgctcacaggctcttgtgtgaagggcagaagggcaagctctctgcaggcagaatt
cctccctgctttttagttggagaaggagcctacagatgggcagtggatcatgggataccc
tcttgccctcctagcaccatgaccacaagattcagcttagctgcatttaaaaggaacaag
aggaaactagagctggcagaaagggtggaaacagacttcatccagctgaagagaagacga
caatcaagcgcaaaggaaaatgactcaggcactttggacacggtgggtgctgtggtcgtg
gatcacgaagggaatgttgctgctgctgtctccagtgggggcttggccttgaaacatcca
gggagagttgggcaggctgctctttatggatgtggctgctgggctgagaatactggcgct
cagaacccctactccacagctgtgagtacctcaggatgtggcgagcatcttgtgcgcacc
atactggctagagaatgttcacacgctttacaagctgaagatgctcaccaagctctgttg
gagactatgcaaaacaagtttatcagttcacctttccttgcctgtgaagatggcgtgctc
ggtggagtgatcgttctccggtcatgcagatgttcttcagagtctgactcctcccaagat
aaacagacactgcttgtggaatttctgtggagccatactacagagagcatgtgcgtggga
tatatgtcagcccaggacggcaaagccaagactcacatttcacgactccctcctggtgct
gtggcaggacagtctgttgccatcgaaggtggggtttgccgcctggagagccccgtgaac
tga

DBGET integrated database retrieval system