KEGG   Mus musculus (mouse): 75986Help
Entry
75986             CDS       T01002                                 

Gene name
Agmat, 5033405N08Rik
Definition
agmatine ureohydrolase (agmatinase) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    75986 (Agmat)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     75986 (Agmat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 E1; 4
AA seq 358 aa AA seqDB search
MLRLLRSSWARGLGSGVATWRPSAGLFRPGCPGIRQASGASDTPHHQSPSSESPVQPVGV
GVCSMMRLPLQSSPEGLDAAFIGVPLDTGTSNRPGARFGPCRIREESLMLGAVNPSTGAL
PFQSLRVADLGNVNVNLYNLQDSCLLIREAYQNVLAAGCIPLTLGGDQTITYPILQAVAK
EHGPVGLVHVGAHTNTTDKPREEKVYHRTPFRRSVDEGLLDSKRVVQIGIRGSSRTLDPY
RYSRSQGFRVVLAEDCWMKSLVPLMAEVRQQMGGKPLYISFAIDALDPAYAPGTGTPEIA
GLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggctgctgaggtccagctgggcccgcggcttggggtctggggtggccacttgg
cgtccctcagcggggctctttcgtcctgggtgccctgggatccgccaggcttcaggtgcc
tcagataccccacaccaccagtcccccagctctgagtcaccggtacagccggtgggggtg
ggtgtctgttccatgatgcgcctgcccctgcagtcctcccccgaggggctggacgctgct
ttcatcggtgtgcctctggatactgggacttccaaccggcccggggcaagatttggaccc
tgtcgcatccgggaggagtcactgatgctgggggctgtcaaccccagcacgggagctctc
cccttccagtccctcagggttgcagacctaggcaatgtgaacgtcaatctctacaacctc
caggacagctgcctgctgattcgagaggcctatcagaatgtcctcgctgcgggctgcatt
cctctgaccttgggtggagaccaaacaatcacatatcccatactgcaagccgtggcaaag
gagcatggcccggtgggtttagtgcatgtgggtgcccacaccaacaccacggacaaacct
cgggaggagaaggtctaccatcggacacctttccgccgaagtgtggatgagggactgctg
gacagcaagcgagtggtacagataggcatccggggctcctccaggactctggatccctac
agatacagtaggagccagggcttccgtgtggtcctggctgaagactgttggatgaagtca
ctggtccccctgatggcagaggtcaggcagcagatggggggcaagcctctttatatcagc
tttgccatagatgccttggatcctgcctatgccccaggaacagggacaccggaaatcgcg
gggctcacccctagtcaggctctggagatcatccggggctgccaaggcctgaatgtggtg
ggctgcgatcttgtggaagtctccccgccgtatgatctctctggtaacacagccctccta
gcagctaacctgctgtttgagatgctgtgtgctctccccaaagtgacaactgtctga

DBGET integrated database retrieval system