KEGG   Mus musculus (mouse): 76055Help
Entry
76055             CDS       T01002                                 

Gene name
Mgea5, 2810009A20Rik, 4833427O07Rik, 5830447M11Rik, AA408215, Hy5, Ncoat, mKIAA0679
Definition
meningioma expressed antigen 5 (hyaluronidase) (EC:2.3.1.48 3.2.1.169)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     76055 (Mgea5)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     76055 (Mgea5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 D1; 19 38.75 cM
AA seq 916 aa AA seqDB search
MVQKESQAALEERESERNANPAAASGASLEQSVAPAPGEDNPSGAGAAAVVGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEK
LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE
NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKTSVVDGTPLVAA
PSLNATTVVTTVYQEPIMSQGAALSGEPSVLTKEEEKKQPDEEPMDMVVEKQEEAEHKND
NQILTEIVEAKMAEELRPMDTDKESMAESKSPEMSMQEDCIPDVAPMQTDEQTQKEQFVP
GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
SEKIEEWRSRAAKFEEMCALVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQW
LGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY
FPKDEASVYKICREMYDDGVGFPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYA
LGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP
SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA
KMEGFPKDVVILGRSL
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaggagagccaggcggcgctggaggagcgggagagcgagcgcaacgccaac
cctgccgccgcctcgggggcttcgttggagcagtcggtagctcccgcccccggagaagat
aacccatcgggagccggggctgcggccgtggtcggggcggccggaggggcccgcaggttc
ctgtgcggtgtcgtggaagggttttatggaagaccttgggttatggagcagagaaaagag
ctctttagaaggcttcagaaatgggaattaaacacatacttgtatgctccaaaagatgac
tacaaacataggatgttttggcgagagatgtattcagtggaagaagctgagcaacttatg
actctgatctctgctgcacgagaatatgaaatagaattcatctatgctatttcgccagga
ctagatatcactttttctaaccccaaggaagtatcaacgttgaaacgcaaattggaccag
gtctctcagtttgggtgcaggtcgtttgctttgctttttgatgatattgaccataatatg
tgtgcagcagacaaagaggtgttcagttcttttgcacatgcacaagtttccatcaccaat
gaaatttatcagtacctgggagagccagaaaccttcctcttctgccctacagaatactgt
ggcactttctgttatccaaatgtatctcagtctccttacttgaggactgtgggtgagaag
cttctacctggaattgaggtgctttggacaggtccaaaagttgtttcaaaagaaattcca
gtggaatctattgaagaagtttctaagatcattaagagagctccagtgatctgggataac
attcatgctaatgattatgatcagaagaggctgtttctgggtccctacaaaggaagatcc
acagagctcatcccacggttaaagggagtactaaccaatccaaattgtgaatttgaagct
aactacgttgccatacacacccttgccacttggtacaagtcaaacatgaacggagtgagg
aaggatgtggtgatgactgacagtgaagacagtactgtatcaatacagataaagttagaa
aatgaaggcagtgacgaagacattgagactgatgttctctacagcccacagatggcttta
aagctggctttaactgagtggctgcaggagttcggtgtccctcatcagtacagcagtagg
caagttgcacacagtggagctaagacaagtgtagttgatgggactcccttagttgctgca
ccctctttaaatgccacaactgtagttacaacagtttaccaggagcccattatgagccag
ggagcagctttgagtggtgaaccctcagttctgaccaaggaagaggaaaagaaacagcca
gatgaggaacccatggatatggtggtcgaaaagcaagaagaagcagagcacaagaatgac
aaccagatactaactgagattgttgaagcgaagatggcagaggagttgagaccaatggac
acggataaggagagcatggctgagtccaaatccccagagatgtccatgcaggaagactgc
attcctgacgtggctcctatgcagacagatgagcaaacacagaaggagcagtttgtgcca
ggtccaaatgaaaagcctctgtacaccgcagagcctgtgactctggaggacttacagtta
ctcgctgacctgttctaccttccttacgagcacgggcccaaaggagcgcagatgctacgg
gaattccagtggcttcgagcaaacagcagtgttgtcagtgtcaactgcaaagggaaagac
tcagaaaaaatagaagaatggcggtcacgagcagccaagtttgaagagatgtgtgcacta
gtgatggggatgttcacccggctttccaactgtgccaacaggaccatcctttatgacatg
tactcctatgtgtgggacatcaagagtataatgtctatggtgaaatcttttgtgcagtgg
ttagggtgtcgtagtcactcttcagcacagttcttaattggagaccaggagccctgggcc
tttagaggtggtctagcaggagagttccagcgtttgctgccaattgatggagcaaatgat
ctcttttttcaaccacccccactgactccaacctccaaagtttatactatcagaccttat
ttccctaaagatgaggcttccgtgtacaagatttgcagagaaatgtatgatgatggagtg
ggtttcccttttcaaagtcaacctgaccttattggagacaagttagtaggaggactgctc
tccctcagcctggattactgcttcgtcctagaagatgaagatggcatttgtggttatgcc
ttaggcacagtagatgtgacccccttcattaaaaagtgtaaaatttcctggattcccttc
atgcaagagaagtataccaagccaaatggtgacaaagagctctcagaggctgagaaaata
atgttgagtttccatgaagagcaggaggtgttgccagaaactttccttgccaacttccct
tctctgataaaaatggatattcataaaaaagtgactgacccgagtgttgccaaaagcatg
atggcttgcctcctgtcttcactgaaggccaatggctcccggggggctttctgtgaagta
agaccagatgataaaaggattctggaattttacagcaagttaggctgttttgaaattgca
aaaatggaaggatttccaaaggatgtggttatacttggtcgaagcctgtga

DBGET integrated database retrieval system