KEGG   Mus musculus (mouse): 76167Help
Entry
76167             CDS       T01002                                 

Gene name
Snrnp35, 6330548G22Rik
Definition
(RefSeq) small nuclear ribonucleoprotein 35 (U11/U12)
  KO
K13155  
U11/U12 small nuclear ribonucleoprotein 35 kDa protein
Organism
mmu  Mus musculus (mouse)
Brite
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome specific factors
    76167 (Snrnp35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 F
AA seq 244 aa AA seqDB search
MSDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVTGDPLLTLFVARLNL
QTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERALMKAYRDADGLVIDQH
EIFVDYELERTLRGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNEPHREGK
RERRERSRSRDRHWDPRPRERDHDRGREKHWQERARVWPENDWEREREFREERVKSRDKR
DRSK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactggatgcccattgccaaggaatatgacccgcttaaagctggcagcatcgat
ggtacagatgaagacccacatgaccgagctgtgtggagggccatgctggcccgctatgtc
cccaacaaaggagtcaccggagaccccctccttaccctgtttgtggcacgactgaacttg
cagaccaaagaggaaaagttaaaggaagtcttctcccggtatggtgacattcggcggctg
aggctggttcgggacctggtgacaggcttctccaagggctacgccttcattgagtacaag
gaggagagggccctgatgaaggcctacagagatgctgatggcctggtcattgaccagcac
gagatattcgtggactatgagctagagaggactctccgtggctggatccctcggcggctg
ggtggcggattgggtgggaaaaaggaatctgggcagctgaggttcggtgggcgagatcgg
cctttccgaaaacccattaacttgccagttgtcaagaatgagccacatagagaagggaaa
agggaaaggagggagcgatctcgatctagggacagacactgggaccccaggcccagggaa
cgggatcatgacaggggccgagagaagcactggcaagagagggccagggtgtggcctgag
aatgattgggaaagagagagggagttcagggaggagagggtcaaaagccgggacaagagg
gacagaagtaagtag

DBGET integrated database retrieval system